1. GPCR/G Protein Neuronal Signaling
  2. Neuropeptide Y Receptor
  3. Pancreatic polypeptide

Pancreatic polypeptide is a peptide secreted by the endocrine PP cells of the pancreas that regulates pancreatic secretory activity and also affects hepatic glycogen stores and gastrointestinal secretion.

For research use only. We do not sell to patients.

Pancreatic polypeptide Chemical Structure

Pancreatic polypeptide Chemical Structure

CAS No. : 59763-91-6

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Pancreatic polypeptide is a peptide secreted by the endocrine PP cells of the pancreas that regulates pancreatic secretory activity and also affects hepatic glycogen stores and gastrointestinal secretion[1].

In Vitro

Pancreatic polypeptid (PP) (0.1 μM, 48 h) causes a significant reduction in growth inhibitory hormone secretion in mHippo E18 cells[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

Pancreatic polypeptid (PP)(1 μM, Hippocampal injection, 0.2 μL/min followed by 3 min) stimulates the expression of the neuronal activation marker c-Fos in growth inhibitor-containing cells in the male B6C3F1/J mice brain, indicating that it activates growth inhibitor-containing cells in the mouse hippocampus[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Clinical Trial
Molecular Weight

4182.70

Formula

C185H286N52O55S2

CAS No.
Sequence

Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2

Sequence Shortening

APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2

SMILES

[APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2]

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Pancreatic polypeptide
Cat. No.:
HY-P4060
Quantity:
MCE Japan Authorized Agent: