1. Membrane Transporter/Ion Channel
  2. Sodium Channel
  3. Phlo1b

Phlo1b (μ-TrTx-Phlo1b) is a peptide toxin contains 35-amino acid residues. Phlo1b is a selective Nav1.7 inhibitor. Phlo1b has a weak inhibitory effect on Nav1.2 and Nav1.5.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Phlo1b Chemical Structure

Phlo1b Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products

View All Sodium Channel Isoform Specific Products:

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Phlo1b (μ-TrTx-Phlo1b) is a peptide toxin contains 35-amino acid residues. Phlo1b is a selective Nav1.7 inhibitor. Phlo1b has a weak inhibitory effect on Nav1.2 and Nav1.5[1].

IC50 & Target[1]

Nav1.7

 

Molecular Weight

4140.71

Formula

C181H260N52O49S6

Sequence

Ala-Cys-Arg-Glu-Leu-Leu-Gly-Gly-Cys-Ser-Lys-Asp-Ser-Asp-Cys-Cys-Ala-His-Leu-Glu-Cys-Arg-Lys-Lys-Trp-Pro-Tyr-His-Cys-Val-Trp-Asp-Trp-Thr-Phe-NH2 (Disulfide bridge: Cys2-Cys16,Cys9-Cys21,Cys15-Cys29)

Sequence Shortening

ACRELLGGCSKDSDCCAHLECRKKWPYHCVWDWTF-NH2 (Disulfide bridge: Cys2-Cys16,Cys9-Cys21,Cys15-Cys29)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Phlo1b
Cat. No.:
HY-P5800
Quantity:
MCE Japan Authorized Agent: