Phrixotoxin-1 TFA

Name: Phrixotoxin-1 TFA
Brand: MedChemExpress
SKU: HY-P2785A
Rating: 4.5 (1 reviews)

Cat. No.: HY-P2785A Purity: 96.46%: FAQs
Data Sheet SDS COA Handling Instructions

Molarity Calculator

Phrixotoxin-1 (TFA), from the venom of the theraphosid spider Phrixotrichus auratus, is a specific peptide inhibitor of Kv4 potassium channel.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Phrixotoxin-1 TFA Chemical Structure

Size	Price	Stock	Quantity
1 mg	USD 350	In-stock	Estimated Time of Arrival: December 31
5 mg	USD 880	In-stock	Estimated Time of Arrival: December 31
10 mg	USD 1400	In-stock	Estimated Time of Arrival: December 31
50 mg		Get quote
100 mg		Get quote

or Bulk Inquiry

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Phrixotoxin-1 TFA:

Phrixotoxin-1 Get quote

Featured Recommendations

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description

Phrixotoxin-1 (TFA), from the venom of the theraphosid spider Phrixotrichus auratus, is a specific peptide inhibitor of Kv4 potassium channel^[1]^[2].

Molecular Weight

3548.30 (free base)

Formula

C₁₅₆H₂₄₀N₄₄O₃₇S₇.xC₂HF₃O₂

Appearance

Solid

Color

White to off-white

Sequence

Tyr-Cys-Gln-Lys-Trp-Met-Trp-Thr-Cys-Asp-Ser-Ala-Arg-Lys-Cys-Cys-Glu-Gly-Leu-Val-Cys-Arg-Leu-Trp-Cys-Lys-Lys-Ile-Ile-NH2 (Disulfide bridge: Cys2-Cys16; Cys9-Cys21; Cys15-Cys25)

Sequence Shortening

YCQKWMWTCDSARKCCEGLVCRLWCKKII-NH2 (Disulfide bridge: Cys2-Cys16; Cys9-Cys21; Cys15-Cys25)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Solvent & Solubility

In Vitro:

H₂O : ≥ 100 mg/mL

*"≥" means soluble, but saturation unknown.

Molarity Calculator
Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)

Volume _(start)

Concentration _(final)

Volume _(final)

In Vivo Dissolution Calculator

Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.

Calculation results:

Working solution concentration: mg/mL

This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.

The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).

Purity & Documentation

Purity: 96.46%

Select Batch:

Data Sheet (283 KB) SDS (252 KB)

COA (267 KB) RP-HPLC (112 KB) MS (219 KB)

Handling Instructions (2659 KB)

References

[1]. Benjamin Chagot, et al. Solution structure of Phrixotoxin 1, a specific peptide inhibitor of Kv4 potassium channels from the venom of the theraphosid spider Phrixotrichus auratus. Protein Sci. 2004, 13, 5. [Content Brief]

[2]. Grit Schaarschmidt, et al. Characterization of Voltage-Gated Potassium Channels in Human Neural Progenitor Cells. PLoS One. 2009, 4, 7. [Content Brief]