1. Membrane Transporter/Ion Channel
  2. Sodium Channel
  3. Phrixotoxin 3-NH2 TFA

Phrixotoxin 3-NH2 TFA is a derivative of Phrixotoxin 3 TFA (HY-P1218A). Phrixotoxin 3 TFA is a potent blocker of voltage-gated sodium channels, with IC50s of 0.6, 42, 72, 288, 610 nM for NaV1.2, NaV1.3, NaV1.4, NaV1.1 and NaV1.5, respectively. Phrixotoxin 3 TFA modulates voltage-gated sodium channels with properties similar to those of typical gating-modifier toxins, both by causing a depolarizing shift in gating kinetics and by blocking the inward component of the sodium current.

For research use only. We do not sell to patients.

Phrixotoxin 3-NH2 TFA Chemical Structure

Phrixotoxin 3-NH2 TFA Chemical Structure

Size Price Stock Quantity
100 μg In-stock
500 μg In-stock
1 mg In-stock
5 mg   Get quote  
10 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of Phrixotoxin 3-NH2 TFA:

Top Publications Citing Use of Products

View All Sodium Channel Isoform Specific Products:

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Phrixotoxin 3-NH2 TFA is a derivative of Phrixotoxin 3 TFA (HY-P1218A). Phrixotoxin 3 TFA is a potent blocker of voltage-gated sodium channels, with IC50s of 0.6, 42, 72, 288, 610 nM for NaV1.2, NaV1.3, NaV1.4, NaV1.1 and NaV1.5, respectively. Phrixotoxin 3 TFA modulates voltage-gated sodium channels with properties similar to those of typical gating-modifier toxins, both by causing a depolarizing shift in gating kinetics and by blocking the inward component of the sodium current[1].

Molecular Weight

4058.74 (free base)

Formula

C176H270N52O47S6.xC2HF3O2

Appearance

Solid

Color

White to off-white

Sequence

Asp-Cys-Leu-Gly-Phe-Leu-Trp-Lys-Cys-Asn-Pro-Ser-Asn-Asp-Lys-Cys-Cys-Arg-Pro-Asn-Leu-Val-Cys-Ser-Arg-Lys-Asp-Lys-Trp-Cys-Lys-Tyr-Gln-Ile-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys23;Cys16-Cys30)

Sequence Shortening

DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys23;Cys16-Cys30)

SMILES

O=C(N[C@@H](CSSC[C@@H](C(N[C@@H](CCCNC(N)=N)C(N1[C@@H](CCC1)C(N[C@@H](CC(N)=O)C(N[C@@H](CC(C)C)C(N[C@H]2C(C)C)=O)=O)=O)=O)=O)NC3=O)C(N[C@@H](CC(C)C)C(NCC(N[C@@H](CC4=CC=CC=C4)C(N[C@@H](CC(C)C)C(N[C@@H](CC5=CNC6=CC=CC=C56)C(N[C@@H](CCCCN)C(N[C@@H](CSSC[C@@H](C(N[C@@H](CO)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCCN)C(N[C@@H](CC(O)=O)C(N[C@@H](CCCCN)C(N[C@H]7CC8=CNC9=CC=CC=C89)=O)=O)=O)=O)=O)=O)NC2=O)C(N[C@@H](CC(N)=O)C(N%10[C@@H](CCC%10)C(N[C@@H](CO)C(N[C@@H](CC(N)=O)C(N[C@@H](CC(O)=O)C(N[C@@H](CCCCN)C(N[C@H]3CSSC[C@@H](C(N[C@@H](CCCCN)C(N[C@@H](CC%11=CC=C(C=C%11)O)C(N[C@@H](CCC(N)=O)C(N[C@@H]([C@@H](C)CC)C(N)=O)=O)=O)=O)=O)NC7=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CC(O)=O)N.OC(C(F)(F)F)=O.[x]

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Phrixotoxin 3-NH2 TFA Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Phrixotoxin 3-NH2 TFA
Cat. No.:
HY-P1218B
Quantity:
MCE Japan Authorized Agent: