1. Apoptosis
  2. MDM-2/p53
  3. PNC-27

PNC-27, a chimeric p53-penetratin peptide binds to HDM-2 in a p53 peptide-like structure, induces selective membrane-pore formation and leads to cancer cell lysis. PNC-27 is an anticancer peptide. PNC-27 can be used in acute myeloid leukemia research.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

PNC-27 Chemical Structure

PNC-27 Chemical Structure

CAS No. : 1159861-00-3

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of PNC-27:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

PNC-27, a chimeric p53-penetratin peptide binds to HDM-2 in a p53 peptide-like structure, induces selective membrane-pore formation and leads to cancer cell lysis. PNC-27 is an anticancer peptide. PNC-27 can be used in acute myeloid leukemia research[1][2][3].

In Vitro

PNC-27 (50 μg/mL; 0-3 h) induces cancer cell death[1].
PNC-27 (50 μg/mL; 15 min) binds to cell membrane-bound HDM-2 in A2058 and MCF-7 cells[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Cell Cytotoxicity Assay[1]

Cell Line: MIA-PaCa-2 cells
Concentration: 50 μg/mL
Incubation Time: 0-3 hours
Result: Induced 100% cell death in 90 min.

Immunofluorescence[1]

Cell Line: A2058 and MCF-7 cells
Concentration: 50 μg/mL
Incubation Time: 15 min
Result: Showed colocalization of PNC-27 with HDM-2 in the cancer cell membrane.
In Vivo

PNC-27 (intraperitoneal injection; 40 mg/kg; once daily; 2-3 w) shows anti-leukemia activity in mice[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: MllPTD/WT/Flt3ITD/ITD AML mice[2]
Dosage: 40 mg/kg
Administration: Intraperitoneal injection; 40 mg/kg; once daily; 2 or 3 weeks
Result: Reduced AML engraftment and prolonged survival.
Molecular Weight

4031.73

Formula

C188H293N53O44S

CAS No.
Sequence Shortening

PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PNC-27
Cat. No.:
HY-P3508
Quantity:
MCE Japan Authorized Agent: