Prepro-Atrial Natriuretic Factor (26-55) (human)

Cat. No.: HY-P4811 Purity: 98.27%: FAQs
Data Sheet SDS COA Handling Instructions Technical Support

Prepro-Atrial Natriuretic Factor (26-55) (human) is a polypeptide that increases renal cortical and medullary cyclic GMP levels. Prepro-Atrial Natriuretic Factor (26-55) (human) increases renal guanylate cyclase activity.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Prepro-Atrial Natriuretic Factor (26-55) (human) Chemical Structure

CAS No. : 112160-82-4

Size	Stock	Quantity
1 mg	In-stock	Estimated Time of Arrival: December 31
5 mg	In-stock	Estimated Time of Arrival: December 31
10 mg	In-stock	Estimated Time of Arrival: December 31
50 mg	Get quote
100 mg	Get quote

or Bulk Inquiry

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Featured Recommendations

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description

Molecular Weight

3507.92

Formula

C₁₅₂H₂₃₆N₃₈O₅₁S₃

CAS No.

112160-82-4

Appearance

Solid

Color

White to off-white

Sequence

Asn-Pro-Met-Tyr-Asn-Ala-Val-Ser-Asn-Ala-Asp-Leu-Met-Asp-Phe-Lys-Asn-Leu-Leu-Asp-His-Leu-Glu-Glu-Lys-Met-Pro-Leu-Glu-Asp

Sequence Shortening

NPMYNAVSNADLMDFKNLLDHLEEKMPLED

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility

In Vitro:

DMSO : ≥ 100 mg/mL (28.51 mM; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

*"≥" means soluble, but saturation unknown.

Preparing
Stock Solutions

Concentration Solvent Mass	1 mg	5 mg	10 mg

1 mM	0.2851 mL	1.4253 mL	2.8507 mL
5 mM	0.0570 mL	0.2851 mL	0.5701 mL
10 mM	0.0285 mL	0.1425 mL	0.2851 mL

View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Molarity Calculator
Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)

Volume _(start)

Concentration _(final)

Volume _(final)

In Vivo Dissolution Calculator

Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.

Calculation results:

Working solution concentration: mg/mL

Purity & Documentation

Purity: 98.27%

Select Batch:

Data Sheet (279 KB) SDS (252 KB)

COA (259 KB) RP-HPLC (113 KB) MS (222 KB)

Handling Instructions (2659 KB)

References

[1]. Vesely DL, et al. Human prepro atrial natriuretic factors 26-55, 56-92, and 104-123 increase renal guanylate cyclase activity. Biochem Biophys Res Commun. 1987 Feb 27;143(1):186-93. [Content Brief]

Complete Stock Solution Preparation Table

Optional Solvent	Concentration Solvent Mass	1 mg	5 mg	10 mg	25 mg

DMSO	1 mM	0.2851 mL	1.4253 mL	2.8507 mL	7.1267 mL
	5 mM	0.0570 mL	0.2851 mL	0.5701 mL	1.4253 mL
	10 mM	0.0285 mL	0.1425 mL	0.2851 mL	0.7127 mL
	15 mM	0.0190 mL	0.0950 mL	0.1900 mL	0.4751 mL
	20 mM	0.0143 mL	0.0713 mL	0.1425 mL	0.3563 mL
	25 mM	0.0114 mL	0.0570 mL	0.1140 mL	0.2851 mL