1. Membrane Transporter/Ion Channel
  2. Sodium Channel
  3. Pterinotoxin-2

Pterinotoxin-2 is a sodium channel inhibitor peptide toxin.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Pterinotoxin-2 Chemical Structure

Pterinotoxin-2 Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products

View All Sodium Channel Isoform Specific Products:

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Pterinotoxin-2 is a sodium channel inhibitor peptide toxin[1].

IC50 & Target

Nav1.3

 

Nav1.7

 

Molecular Weight

3639.28

Formula

C156H237N45O42S7

Sequence

Tyr-Cys-Gln-Glu-Phe-Leu-Trp-Thr-Cys-Asp-Glu-Glu-Arg-Lys-Cys-Cys-Gly-Asp-Met-Val-Cys-Arg-Leu-Trp-Cys-Lys-Lys-Arg-Leu-NH2 (Disulfide bridge: Cys2-Cys16,Cys9-Cys21,Cys15-Cys25)

Sequence Shortening

YCQEFLWTCDEERKCCGDMVCRLWCKKRL-NH2 (Disulfide bridge: Cys2-Cys16,Cys9-Cys21,Cys15-Cys25)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Pterinotoxin-2
Cat. No.:
HY-P5942
Quantity:
MCE Japan Authorized Agent: