14-3-3 epsilon Protein, Human (GST)

14-3-3 epsilon Protein, Human (GST) is a mediator that guides chondrocytes toward an inflammatory phenotype with GST tag^[1].

14-3-3ε is able to induce an inflammatory phenotype in synoviocytes, macrophages and chondrocytes in addition to polarizing macrophages. 14-3-3ε acts as an alarmin in osteoarthritis (OA) and as a target either for therapeutic and/or prognostic purposes^[1].

Human

E. coli

N-GST

P62258/NP_006752.1 (M1-Q255)

7531  [NCBI]

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKMDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ

Approximately 58.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 6.0. (Due to the optimization of production process, the components of different batches may vary slightly.)

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O or PBS.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. M Millerand, et al. Activation of Innate Immunity by 14-3-3 ε, a New Potential Alarmin in Osteoarthritis. Osteoarthritis Cartilage. 2020 May;28(5):646-657.  [Content Brief]