15-PGDH/HPGD Protein, Mouse (His)

The 15-PGDH/HPGD protein catalyzes the NAD-dependent dehydrogenation of various hydroxylated polyunsaturated fatty acids (mainly eicosanoids and behenic acid). 15-PGDH/HPGD Protein, Mouse (His) is the recombinant mouse-derived 15-PGDH/HPGD protein, expressed by E. coli , with C-His labeled tag. The total length of 15-PGDH/HPGD Protein, Mouse (His) is 269 a.a., with molecular weight of ~30 kDa.

15-PGDH/HPGD protein plays a pivotal role in catalyzing the NAD-dependent dehydrogenation (oxidation) of a diverse range of hydroxylated polyunsaturated fatty acids, predominantly eicosanoids and docosanoids, including prostaglandins, lipoxins, and resolvins, resulting in the formation of their corresponding keto (oxo) metabolites. This enzymatic activity is crucial for modulating cellular responses, particularly by reducing the levels of pro-proliferative prostaglandins such as prostaglandin E2. By generating oxo-fatty acid products, 15-PGDH/HPGD can profoundly influence cell function and counteract the inflammatory effects of certain cytokines. Furthermore, the enzyme plays a role in inactivating resolvins, including resolvins E1, D1, and D2, which are involved in the resolution phase of acute inflammation and obesity-induced adipose inflammation.

Measure by the production of NADH during the oxidation of PGF2 alpha of 0.4 mM that incubate at room temperature in kinetic mode for 5 minutes. The specific activity is 1511.254 pmol/min/μg.

Mouse

E. coli

C-6*His

Q8VCC1 (M1-S269)

15446  [NCBI]

MHVNGKVALVTGAAQGIGKAFAEALLLHGAKVALVDWNLEAGVKCKAALDEQFEPQKTLFVQCDVADQKQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEQTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIIGFTRSAAMAANLMKSGVRLNVICPGFVDTPILESIEKEENMGQYIEYKDQIKAMMKFYGVLHPSTIANGLINLIEDDALNGAIMKITASKGIHFQDYDISPLLVKAPLTS

Approximately 30 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 8% trehalose, 8% mannitol and 0.02% Tween80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.