1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Stimulatory Immune Checkpoint Molecules NK Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins
  4. 2B4/CD244
  5. 2B4/CD244 Protein, Human (HEK293, His)

2B4/CD244 protein exhibits heightened affinity for binding to CD48, surpassing isoform 1, leading to increased cytotoxicity and intracellular calcium release. The stronger interaction implies more robust engagement, potentially amplifying cellular responses, particularly heightened cytotoxic activity and intracellular calcium release. 2B4/CD244 Protein, Human (HEK293, His) is the recombinant human-derived 2B4/CD244 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

2B4/CD244 protein exhibits heightened affinity for binding to CD48, surpassing isoform 1, leading to increased cytotoxicity and intracellular calcium release. The stronger interaction implies more robust engagement, potentially amplifying cellular responses, particularly heightened cytotoxic activity and intracellular calcium release. 2B4/CD244 Protein, Human (HEK293, His) is the recombinant human-derived 2B4/CD244 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The 2B4/CD244 protein demonstrates a higher affinity for binding to CD48 compared to isoform 1, and this interaction results in heightened cytotoxicity and intracellular calcium release. The stronger binding between 2B4/CD244 and CD48 suggests a more robust engagement, potentially leading to enhanced cellular responses, including increased cytotoxic activity and release of intracellular calcium.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9BZW8-2 (C22-R221)

Gene ID
Molecular Construction
N-term
CD244 (C22-R221)
Accession # Q9BZW8-2
6*His
C-term
Synonyms
Natural killer cell receptor 2B4; NAIL; NKR2B4; h2B4; SLAMF4; CD244; 2B4
AA Sequence

CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFR

Molecular Weight

35-60 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
2B4/CD244 Protein, Human (HEK293, His)
Cat. No.:
HY-P72745
Quantity:
MCE Japan Authorized Agent: