1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules Dendritic Cell CD Proteins Epithelial cell CD Proteins
  4. TNF Superfamily Ligands 4-1BBL/CD137L
  5. 4-1BBL
  6. 4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc)

4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc)

Cat. No.: HY-P700435
Handling Instructions

4-1BBL/TNFSF9 protein is a cytokine that selectively binds to TNFRSF9 and exerts its effects by inducing the proliferation of activated peripheral blood T cells. As a homotrimer, this ligand demonstrates its potential role in activation-induced cell death (AICD) and may be involved in coordinating homologous interactions between T cells and B cells/macrophages. 4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc) is the recombinant human-derived 4-1BBL/TNFSF9 protein, expressed by HEK293 , with N-Myc, N-hFc labeled tag. The total length of 4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc) is 184 a.a., with molecular weight of 48.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

4-1BBL/TNFSF9 protein is a cytokine that selectively binds to TNFRSF9 and exerts its effects by inducing the proliferation of activated peripheral blood T cells. As a homotrimer, this ligand demonstrates its potential role in activation-induced cell death (AICD) and may be involved in coordinating homologous interactions between T cells and B cells/macrophages. 4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc) is the recombinant human-derived 4-1BBL/TNFSF9 protein, expressed by HEK293 , with N-Myc, N-hFc labeled tag. The total length of 4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc) is 184 a.a., with molecular weight of 48.0 kDa.

Background

The 4-1BBL (TNFSF9) protein is a cytokine with significant immunomodulatory functions, binding to the TNFRSF9 receptor. Its interaction induces the proliferation of activated peripheral blood T-cells, suggesting a role in T-cell activation and immune response amplification. Additionally, 4-1BBL may be involved in activation-induced cell death (AICD), a process that regulates the survival and homeostasis of activated immune cells. Furthermore, the protein might play a role in mediating cognate interactions between T-cells and B-cells/macrophages, contributing to immune cell communication and coordination. Structurally, 4-1BBL forms homotrimers, indicating its organization into trimeric complexes. These diverse functions underscore the pivotal role of 4-1BBL in immune regulation and intercellular communication within the immune system.

In Vitro

4-1BB (human; 1 μg/mL; 16 h) leads to induction of monocyte activation and induces Myc protein production[4].
4-1BB (human; 1 μg/mL; 1 d) prolongs survival of peripheral monocytes and (1 μg/mL; 1 h) induces expression of M-CSF[5].
4-1BB (human; 1.2-4 μg/mL; 7 d) exhibits nhancement of cell numbers dose-dependently[6].

Species

Human

Source

HEK293

Tag

N-Myc;N-hFc

Accession

P41273 (R71-E254)

Gene ID
Molecular Construction
N-term
hFc-Myc
4-1BBL (R71-E254)
Accession # P41273
C-term
Synonyms
Tumor necrosis factor ligand superfamily member 9; CD137L; 4-1BB Ligand
AA Sequence

REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

Molecular Weight

48.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc)
Cat. No.:
HY-P700435
Quantity:
MCE Japan Authorized Agent: