4-1BBL/TNFSF9 Protein, Human (His)

4-1BBL/TNFSF9 protein is a cytokine that selectively binds to TNFRSF9 and exerts its effects by inducing the proliferation of activated peripheral blood T cells. As a homotrimer, this ligand demonstrates its potential role in activation-induced cell death (AICD) and may be involved in coordinating homologous interactions between T cells and B cells/macrophages. 4-1BBL/TNFSF9 Protein, Human (His) is the recombinant human-derived 4-1BBL/TNFSF9 protein, expressed by E. coli , with N-6*His labeled tag. The total length of 4-1BBL/TNFSF9 Protein, Human (His) is 203 a.a., with molecular weight of 25.3 kDa.

The 4-1BBL (TNFSF9) protein is a cytokine with significant immunomodulatory functions, binding to the TNFRSF9 receptor. Its interaction induces the proliferation of activated peripheral blood T-cells, suggesting a role in T-cell activation and immune response amplification. Additionally, 4-1BBL may be involved in activation-induced cell death (AICD), a process that regulates the survival and homeostasis of activated immune cells. Furthermore, the protein might play a role in mediating cognate interactions between T-cells and B-cells/macrophages, contributing to immune cell communication and coordination. Structurally, 4-1BBL forms homotrimers, indicating its organization into trimeric complexes. These diverse functions underscore the pivotal role of 4-1BBL in immune regulation and intercellular communication within the immune system.

4-1BB (human; 1 μg/mL; 16 h) leads to induction of monocyte activation and induces Myc protein production^[4].
4-1BB (human; 1 μg/mL; 1 d) prolongs survival of peripheral monocytes and (1 μg/mL; 1 h) induces expression of M-CSF^[5].
4-1BB (human; 1.2-4 μg/mL; 7 d) exhibits nhancement of cell numbers dose-dependently^[6].

Human

E. coli

N-6*His

P41273 (P52-E254)

8744  [NCBI]

PWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

25.3 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.