ACPS Protein, Streptococcus pyogenes serotype M28 (His)

ACPS, an essential enzyme in cellular processes, transfers the 4'-phosphopantetheine moiety from coenzyme A to a serine residue of acyl-carrier-protein. ACPS Protein, Streptococcus pyogenes serotype M28 (His) is the recombinant ACPS protein, expressed by E. coli , with N-6*His labeled tag. The total length of ACPS Protein, Streptococcus pyogenes serotype M28 (His) is 118 a.a., with molecular weight of ~15 kDa.

ACPS, an essential enzyme in various cellular processes, operates by transferring the 4'-phosphopantetheine moiety from coenzyme A to a serine residue of acyl-carrier-protein.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Others

E. coli

N-6*His

Q48RM7 (M1-K118)

/

MIVGHGIDLQEISAIEKVYQRNPRFAQKILTEQELAIFESFPYKRRLSYLAGRWAGKEAFAKAIGTGIGRLTFQDIEILNDVRGCPILTKSPFKGNSFISISHSGNYVQASVILEDKK

Approximately 15 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, 700 mM arginine, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.