1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Acyl-protein thioesterase 2/LYPLA2 Protein, Human (His)

Acyl-protein thioesterase 2/LYPLA2 Protein, Human (His)

Cat. No.: HY-P70221
SDS COA Handling Instructions Technical Support

Acyl-protein thioesterase 2/LYPLA2 Protein, Human (His) a protein palmitoyl thioesterase, is a cytosolic enzyme that catalyze depalmitoylation of membrane-anchored, growth-associated protein-43 (GAP-43).

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Acyl-protein thioesterase 2/LYPLA2 Protein, Human (His) a protein palmitoyl thioesterase, is a cytosolic enzyme that catalyze depalmitoylation of membrane-anchored, growth-associated protein-43 (GAP-43).

Background

In mammals, palmitoylation is catalyzed by a family of 23 enzymes called palmitoyl acyltransferases (PATs)3, whereas depalmitoylation is catalyzed by four thioesterases. Two of these thioesterases, acyl-protein thioesterase-1 (APT1) and APT2, are localized predominantly in the cytoplasm, and the other two, palmitoyl-protein thioesterase-1 (PPT1) and PPT2, are lysosomal enzymes. Acyl-protein thioesterase 2 (APT2), has been reported to depalmitoylate GAP-43 (growth-associated protein 43)[1].

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

O95372 (M1-V231)

Gene ID
Molecular Construction
N-term
LYPA2 (M1-V231)
Accession # O95372
6*His
C-term
Synonyms
rHuAcyl-protein thioesterase 2/LYPLA2, His; Acyl-Protein Thioesterase 2; APT-2; Lysophospholipase II; LPL-II; LysoPLA II; LYPLA2; APT2
AA Sequence

MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV

Molecular Weight

Approximately 28.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris, 1 mM DTT, 0.1 M NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

Acyl-protein thioesterase 2/LYPLA2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Acyl-protein thioesterase 2/LYPLA2 Protein, Human (His)
Cat. No.:
HY-P70221
Quantity:
MCE Japan Authorized Agent: