2. Recombinant Proteins
  3. Enzymes & Regulators
  4. Hydrolases (EC 3)
  5. ACYP1 Protein, Human (His)

ACYP1 Protein, Human (His)

Cat. No.: HY-P7458
Handling Instructions

ACYP1 Protein, Human (His) is human recombinant Acylphosphatase-1 (ACYP1) with an N-terminal His tag. Recombinant Human Acylphosphatase-1, His is expressed in E. coli.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

ACYP1 Protein, Human (His) is human recombinant Acylphosphatase-1 (ACYP1) with an N-terminal His tag. Recombinant Human Acylphosphatase-1, His is expressed in E. coli.
Background

Acylphosphatase-1 (ACYP1) is a small cytosolic enzyme which catalyzes the hydrolysis of the carboxyl-phosphate bond of acylphosphates. Acylphosphatase is widely distributed in human in two isoenzymatic forms, named ACYP1 and ACYP2. Human ACYP1 gene spans about 10 Kbp and contains two exons of 84 bp and 123 bp. The classic intron-exon junction signal sequences and the polyadenilation site at the end of the gene are present[1].
Species

Human
Source

E. coli
Tag

N-6*His
Accession

P07311 (M1-K99)
Gene ID

97  [NCBI]
Molecular Construction
N-term
6*His
ACYP1 (M1-K99)
Accession # P07311
C-term
Synonyms
rHuAcylphosphatase-1, His; ACYP-1; Acylphosphatase 1
AA Sequence

HHHHHHMAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK

Molecular Weight

Approximately 14.0 kDa
Purity

Greater than 80% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)
References

ACYP1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ACYP1 Protein, Human (His)
Cat. No.:
HY-P7458
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.