ADAM15 Protein, Human (HEK293, C-His)

ADAM15 protein is an active metalloprotease involved in wound healing, cell interactions, and T cell recruitment. It inhibits airway smooth muscle cell adhesion and migration mediated by beta-1 integrin. ADAM15 Protein, Human (HEK293, His) is the recombinant human-derived ADAM15 protein, expressed by HEK293 , with C-His labeled tag. The total length of ADAM15 Protein, Human (HEK293, His) is 490 a.a., with molecular weight of 65-70 kDa.

ADAM15 protein is an active metalloproteinase that possesses gelatinolytic and collagenolytic activity. It is involved in various biological processes, including wound healing, heterotypic intraepithelial cell/T-cell interactions, and homotypic T-cell aggregation. ADAM15 also inhibits the adhesion and migration of airway smooth muscle cells mediated by beta-1 integrin. It suppresses cell motility towards fibronectin, potentially by reducing the expression of alpha-v/beta-1 integrin through the inactivation of ERK1/2. Additionally, ADAM15 cleaves E-cadherin in response to growth factor deprivation and plays a role in glomerular cell migration and pathological neovascularization. It may also have a role in cartilage remodeling. During sperm epididymal maturation and the acrosome reaction, ADAM15 may undergo proteolytic processing. Its disintegrin domain suggests a potential involvement in sperm-egg binding.

Measured by its ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells. The ED₅₀ for this effect is 0.9505 μg/mL.

Human

HEK293

C-10*His

Q13444 (D207-T696)

8751

DVVTETKTVELVIVADHSEAQKYRDFQHLLNRTLEVALLLDTFFRPLNVRVALVGLEAWTQRDLVEISPNPAVTLENFLHWRRAHLLPRLPHDSAQLVTGTSFSGPTVGMAIQNSICSPDFSGGVNMDHSTSILGVASSIAHELGHSLGLDHDLPGNSCPCPGPAPAKTCIMEASTDFLPGLNFSNCSRRALEKALLDGMGSCLFERLPSLPPMAAFCGNMFVEPGEQCDCGFLDDCVDPCCDSLTCQLRPGAQCASDGPCCQNCQLRPSGWQCRPTRGDCDLPEFCPGDSSQCPPDVSLGDGEPCAGGQAVCMHGRCASYAQQCQSLWGPGAQPAAPLCLQTANTRGNAFGSCGRNPSGSYVSCTPRDAICGQLQCQTGRTQPLLGSIRDLLWETIDVNGTELNCSWVHLDLGSDVAQPLLTLPGTACGPGLVCIDHRCQRVDLLGAQECRSKCHGHGVCDSNRHCYCEEGWAPPDCTTQLKATSSLTT

Approximately 65-80 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.