1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3) ADAMs/ADAMTSs
  4. ADAM8
  5. ADAM8 Protein, Rhesus Macaque (HEK293, His)

ADAM8 is a transmembrane glycoprotein containing metalloproteinase and disintegrin domains, belonging to the ADAMs family. It has proteolytic, cell adhesion, cell fusion, and cell signaling properties. It is involved in ectodomain shedding of membrane proteins and is associated with inflammation and neurodegeneration. ADAM8 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived ADAM8 protein, expressed by HEK293 , with C-His labeled tag. The total length of ADAM8 Protein, Rhesus Macaque (HEK293, His) is 477 a.a., with molecular weight of ~53.4 KDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ADAM8 is a transmembrane glycoprotein containing metalloproteinase and disintegrin domains, belonging to the ADAMs family. It has proteolytic, cell adhesion, cell fusion, and cell signaling properties. It is involved in ectodomain shedding of membrane proteins and is associated with inflammation and neurodegeneration. ADAM8 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived ADAM8 protein, expressed by HEK293 , with C-His labeled tag. The total length of ADAM8 Protein, Rhesus Macaque (HEK293, His) is 477 a.a., with molecular weight of ~53.4 KDa.

Background

In response to inflammatory stimuli such as lipopolysaccharide (LPS) and tumor necrosis factor alpha (TNF-α), ADAM8 expression is upregulated in macrophages and activated glial cells (astrocytes and microglia) in the central nervous system (CNS), suggesting its involvement in neuronal-glial signaling. ADAM8 has proteolytic, cell adhesion, cell fusion, and cell signaling properties. It is involved in ectodomain shedding of membrane proteins and is associated with inflammation and neurodegeneration[1][2].

Biological Activity

Measured by its ability to cleave a fluorogenic peptide substrate Mca-PLAQAV-Dpa-RSSSR-NH2. The specific activity is 0.77 pmol/min/μg, as measured under the described conditions.

Species

Rhesus Macaque

Source

HEK293

Tag

C-His

Accession

XP_002805919 (R21-P497)

Gene ID
Molecular Construction
N-term
ADAM8 (R21-P497)
Accession # XP_002805919
His
C-term
Synonyms
ADAM 8; ADAM metallopeptidase domain 8; CD156a; MS2
AA Sequence

RPWARVERYEVVLPRRLPGPRVRRALPSHVGLYPERVSYVLGATGHNFTLHLRKNRDLLGSGYTETYTAANGSEVTEQPRGQDHCFYQGHVEGHPDSAASLSTCAGLRGFFQVGSDLHLIEPLDEGGEGGRHAVYEAEHLLQTAGTCGVSDDSLGSLLGPRTAAVFRPQPGGSLPSRETRYVELYVVADNAEFQMLGSEAAVRHRVLEVVNHVDKLYQKLNFRVVLVGLEIWNRQDRFHVSPHPDVTLENLLAWQAQRLTQRHLQDNVQLITGVDFTGTTVGLARVSAMCSHGSGAVNQDHSKNPVGVACTMAHEMGHNLGMDHDENVQGCHCREPTEAGRCIMAGSIGSTFPRMFSDCSRAYLEGFLEQPQSACLANAPDLSHLVGGPVCGNLFVERGEQCDCGPPEDCRNHCCNSTTCQLAEGAQCAHGTCCQECRVKPAGELCRPKKDTCDLEEFCDGRHPECPEDAFQENGTP

Molecular Weight

Approximately 53.4 kDa.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of 12.5 mM Tris, 5 mM CaCl2, 75 mM NaCl, 50% glycerol or 12 mM Tris-HCL, 5 mM CaCl2, 75 mM NaCl, pH 7.4, 50% Glycerol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

ADAM8 Protein, Rhesus Macaque (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ADAM8 Protein, Rhesus Macaque (HEK293, His)
Cat. No.:
HY-P77293
Quantity:
MCE Japan Authorized Agent: