Adiponectin/Acrp30 Protein, Mouse (HEK293, Fc)

Adiponectin/Acrp30 Protein is a protein hormone and adipokine, the most abundant peptide secreted by adipocytes, which is involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Adiponectin plays a inportant role in obesity-related diseases, insulin resistance/type 2 diabetes and cardiovascular disease. Adiponectin/Acrp30 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Adiponectin/Acrp30 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Adiponectin/Acrp30 Protein, Mouse (HEK293, Fc) is 230 a.a., with molecular weight of 52-70 kDa.

Adiponectin is a protein hormone and adipokine, which is involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Adiponectin has direct actions in liver, skeletal muscle, and the vasculature.Adiponectin exists in the circulation as varying molecular weight forms, produced by multimerization. Adiponectin enhances insulin sensitivity primarily by regulating fatty acid oxidation and inhibiting hepatic glucose production. It can also promote synaptic and memory function in the brain. Adiponectin stimulates AMPK phosphorylation and activation in the liver and skeletal muscle, enhancing glucose utilization and fatty-acid combustion. At the same time, it antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Adiponectin inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. Adiponectin may play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW^{[1][2][3][5][6][7]}.

Mouse

HEK293

C-hFc

Q60994 (E18-N247)

11450  [NCBI]

EDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN

52-70 kDa

Greater than 95% as determined by Tris-Bis PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.