ADIPOR1 Protein, Human (Cell-Free, His, Flag)

ADIPOR1 Protein, a receptor for adiponectin (ADIPOQ), crucially regulates glucose and lipid metabolism, maintaining homeostasis and healthy body weight. Upon ADIPOQ binding, ADIPOR1 activates AMPK, promoting fatty acid oxidation and glucose uptake while inhibiting gluconeogenesis. ADIPOR1 interacts with APPL2, negatively regulating signaling, and with APPL1, enhancing ADIPOQ-induced recruitment and positive regulation of adiponectin signaling. ADIPOR1 Protein, Human (Cell-Free, His, Flag) is the recombinant human-derived ADIPOR1 protein, expressed by E. coli Cell-free , with N-6*His, N-Flag labeled tag. The total length of ADIPOR1 Protein, Human (Cell-Free, His, Flag) is 287 a.a., with molecular weight of 34.8 kDa.

The ADIPOR1 Protein acts as a receptor for adiponectin (ADIPOQ), a vital hormone secreted by adipocytes that plays a crucial role in regulating glucose and lipid metabolism. Its functions are integral to maintaining normal glucose and fat homeostasis, as well as a healthy body weight. Upon binding to ADIPOQ, ADIPOR1 activates a signaling cascade that leads to increased AMP-activated protein kinase (AMPK) activity, resulting in enhanced fatty acid oxidation, elevated glucose uptake, and decreased gluconeogenesis. ADIPOR1 exhibits high affinity for globular adiponectin and lower affinity for full-length adiponectin. It may form homooligomers and heterooligomers with ADIPOR2. The interaction with APPL2 negatively regulates adiponectin signaling, while the interaction with APPL1 is enhanced by ADIPOQ, facilitating the recruitment of APPL1 to ADIPOR1 and positively regulating adiponectin signaling.

Human

E. coli Cell-free

N-6*His;N-Flag

Q96A54 (E89-L375)

51094

EGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL

34.8 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.