1. Recombinant Proteins
  2. Receptor Proteins
  3. ADIPOR1 Protein, Human (Cell-Free)

ADIPOR1 Protein, Human (Cell-Free)

Cat. No.: HY-P702199
SDS COA Handling Instructions

ADIPOR1 Protein, a receptor for adiponectin (ADIPOQ), crucially regulates glucose and lipid metabolism, maintaining homeostasis and healthy body weight. Upon ADIPOQ binding, ADIPOR1 activates AMPK, promoting fatty acid oxidation and glucose uptake while inhibiting gluconeogenesis. ADIPOR1 interacts with APPL2, negatively regulating signaling, and with APPL1, enhancing ADIPOQ-induced recruitment and positive regulation of adiponectin signaling. ADIPOR1 Protein, Human (Cell-Free) is the recombinant human-derived ADIPOR1 protein, expressed by E. coli Cell-free , with tag free. The total length of ADIPOR1 Protein, Human (Cell-Free) is 287 a.a., with molecular weight of 33.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ADIPOR1 Protein, a receptor for adiponectin (ADIPOQ), crucially regulates glucose and lipid metabolism, maintaining homeostasis and healthy body weight. Upon ADIPOQ binding, ADIPOR1 activates AMPK, promoting fatty acid oxidation and glucose uptake while inhibiting gluconeogenesis. ADIPOR1 interacts with APPL2, negatively regulating signaling, and with APPL1, enhancing ADIPOQ-induced recruitment and positive regulation of adiponectin signaling. ADIPOR1 Protein, Human (Cell-Free) is the recombinant human-derived ADIPOR1 protein, expressed by E. coli Cell-free , with tag free. The total length of ADIPOR1 Protein, Human (Cell-Free) is 287 a.a., with molecular weight of 33.0 kDa.

Background

The ADIPOR1 Protein acts as a receptor for adiponectin (ADIPOQ), a vital hormone secreted by adipocytes that plays a crucial role in regulating glucose and lipid metabolism. Its functions are integral to maintaining normal glucose and fat homeostasis, as well as a healthy body weight. Upon binding to ADIPOQ, ADIPOR1 activates a signaling cascade that leads to increased AMP-activated protein kinase (AMPK) activity, resulting in enhanced fatty acid oxidation, elevated glucose uptake, and decreased gluconeogenesis. ADIPOR1 exhibits high affinity for globular adiponectin and lower affinity for full-length adiponectin. It may form homooligomers and heterooligomers with ADIPOR2. The interaction with APPL2 negatively regulates adiponectin signaling, while the interaction with APPL1 is enhanced by ADIPOQ, facilitating the recruitment of APPL1 to ADIPOR1 and positively regulating adiponectin signaling.

Species

Human

Source

E. coli Cell-free

Tag

Tag Free

Accession

Q96A54 (E89-L375)

Gene ID

51094

Molecular Construction
N-term
ADIPOR1 (E89-L375)
Accession # Q96A54
C-term
Synonyms
Adiponectin receptor protein 1; Progestin and adipoQ receptor family member 1; Progestin and adipoQ receptor family member I
AA Sequence

EGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL

Molecular Weight

30 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 0.05% Brij-78, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ADIPOR1 Protein, Human (Cell-Free) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ADIPOR1 Protein, Human (Cell-Free)
Cat. No.:
HY-P702199
Quantity:
MCE Japan Authorized Agent: