2. Recombinant Proteins
  3. Receptor Proteins
  4. G-Protein-Coupled Receptors (GPCRs)
  5. Adenosine Receptor
  6. ADORA2A Protein-VLP, Human (HEK293)

ADORA2A Protein-VLP, a receptor for adenosine, activates adenylyl cyclase through G proteins. Its direct interaction with USP4 and GAS2L2 in the cytoplasmic C-terminal domain suggests regulatory roles. Interactions with DRD4 and NECAB2 imply involvement in diverse cellular signaling pathways. ADORA2A Protein-VLP, Human (HEK293) is the recombinant human-derived ADORA2A protein-VLP, expressed by HEK293 , with tag free. The total length of ADORA2A Protein-VLP, Human (HEK293) is 412 a.a., with molecular weight of The target protein has a predicted MW of.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ADORA2A Protein-VLP, a receptor for adenosine, activates adenylyl cyclase through G proteins. Its direct interaction with USP4 and GAS2L2 in the cytoplasmic C-terminal domain suggests regulatory roles. Interactions with DRD4 and NECAB2 imply involvement in diverse cellular signaling pathways. ADORA2A Protein-VLP, Human (HEK293) is the recombinant human-derived ADORA2A protein-VLP, expressed by HEK293 , with tag free. The total length of ADORA2A Protein-VLP, Human (HEK293) is 412 a.a., with molecular weight of The target protein has a predicted MW of.
Background

The ADORA2A Protein-VLP, functioning as a receptor for adenosine, operates through G proteins to activate adenylyl cyclase. Its cytoplasmic C-terminal domain interacts directly with USP4 and GAS2L2, suggesting potential regulatory roles in cellular processes. Additionally, ADORA2A Protein-VLP may interact with DRD4 and NECAB2, further indicating its involvement in diverse cellular signaling pathways.
Species

Human
Source

HEK293
Tag

Tag Free
Accession

P29274 (M1-S412)
Gene ID

135  [NCBI]
Molecular Construction
N-term
ADORA2A-VLP (M1-S412)
Accession # P29274
C-term
Synonyms
ADORA2A; adenosine A2a receptor; ADORA2; adenosine receptor A2a; RDC8; adenosine A2 receptor; adenosine receptor subtype A2a; hA2aR;
AA Sequence

MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS

Purity

Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

ADORA2A Protein-VLP, Human (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ADORA2A Protein-VLP, Human (HEK293)
Cat. No.:
HY-P700899
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (0 KB) Français - FR (0 KB) Deutsch - DE (0 KB) Norwegian - NO (0 KB) Español - ES (0 KB) Swedish - SV (0 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.