Adrenomedullin/ADM Protein, Human (HEK293, Fc)

Adrenomedullin (ADM) and PAMP serve as potent hypotensive and vasodilatory agents, mainly influencing fluid and electrolyte homeostasis. In the kidney, ADM demonstrates diuretic and natriuretic effects, while both ADM and PAMP directly inhibit aldosterone secretion in the adrenal glands. In the pituitary gland, both peptides suppress basal ACTH secretion at physiologically relevant doses. Additionally, ADM and PAMP act in the brain and pituitary gland, promoting plasma volume loss, complementing their hypotensive effects. These multifaceted actions highlight ADM's role in regulating cardiovascular and hormonal processes related to fluid and electrolyte balance. Adrenomedullin/ADM Protein, Human (HEK293, Fc) is the recombinant human-derived Adrenomedullin/ADM protein, expressed by HEK293, with N-hFc labeled tag. The total length of Adrenomedullin/ADM Protein, Human (HEK293, Fc) is 52 a.a., with molecular weight of ~39 kDa.

Adrenomedullin (ADM) and PAMP are potent hypotensive and vasodilatory agents with numerous reported actions primarily linked to the physiological control of fluid and electrolyte homeostasis. In the kidney, ADM exhibits diuretic and natriuretic effects, while both ADM and PAMP inhibit aldosterone secretion through direct actions on the adrenal glands. In the pituitary gland, both peptides, at physiologically relevant doses, inhibit basal ACTH secretion. Furthermore, ADM and PAMP seem to act in the brain and pituitary gland, facilitating the loss of plasma volume, actions that complement their hypotensive effects in blood vessels. These multifaceted actions underscore the role of ADM in regulating cardiovascular and hormonal processes associated with fluid and electrolyte balance.

Human

HEK293

N-hFc

P35318 (Y95-Y146)

133  [NCBI]

YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY

Approximately 39 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.