ADSL/Adenylosuccinate Lyase Protein, Human (His)

ADSL/Adenylosuccinate Lyase Protein catalyzes two non-sequential steps in de novo AMP synthesis. It converts SAICAR to fumarate and 5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide, contributing to de novo IMP synthesis. Additionally, it converts succinyladenosine monophosphate (SAMP) to AMP and fumarate. ADSL/Adenylosuccinate Lyase Protein, Human (His) is the recombinant human-derived ADSL/Adenylosuccinate Lyase protein, expressed by E. coli , with N-6*His labeled tag. The total length of ADSL/Adenylosuccinate Lyase Protein, Human (His) is 484 a.a., with molecular weight of ~56 kDa.

ADSL (Adenylosuccinate Lyase) protein serves as the catalyst for two non-sequential steps in de novo AMP synthesis. Firstly, it converts (S)-2-(5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamido)succinate (SAICAR) to fumarate along with 5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide, thereby contributing to de novo IMP synthesis. In a separate step, ADSL converts succinyladenosine monophosphate (SAMP) to AMP and fumarate. Through these enzymatic actions, ADSL plays a crucial role in the intricate metabolic pathway leading to the synthesis of adenosine monophosphate (AMP), a fundamental component in nucleotide biosynthesis.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-6*His

P30566-1 (M1-L484)

158  [NCBI]

MAAGGDHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIQEMKSNLENIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFEKQQIGSSAMPYKRNPMRSERCCSLARHLMTLVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAASVVKQEGGDNDLIERIQVDAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVYPLLKPYESVMKVKAELCL

Approximately 56 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 10% Glycerol.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.