AG-2 Protein, Human (HEK293, His, solution)

AG-2 Protein, Human (HEK293, His, solution) is human recombinant AG-2 with a N-terminal His tag. AG-2 Protein, Human (HEK293, His) is expressed in HEK293 cells.

AG-2 (Anterior gradient 2) is a human ortholog of the Xenopus laevis cement gland protein and a member of the protein disulfide isomerase (PDI) family. AG-2 is highly expressed and secreted in malignant cancer types, including breast carcinomas, pancreatic cancer, glioblastoma, prostate cancer and metastatic colorectal cancer. AGR2 is also a pro-oncogenic protein that stimulates EGFR ligand amphiregulin, regulate p53 signaling, and interact with the AAA+ protein Reptin. Overexpressed AG-2 stabilizes HIF-1α in tumor cells^[1][2].

Human

HEK293

C-6*His

O95994 (R21-L175)

10551  [NCBI]

RDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTELHHHHHH

Approximately 18.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filter solution of 20 mM Tris, 200 mM NaCl, 10% Glycerol, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Pan F, et al. Anterior gradient 2 as a supervisory marker for tumor vessel normalization induced by anti-angiogenic treatment. Oncol Lett. 2018 Sep;16(3):3083-3091.  [Content Brief]

  [2]. Luu TT, et al. Overexpression of AGR2 Is Associated With Drug Resistance in Mutant Non-small Cell Lung Cancers. Anticancer Res. 2020 Apr;40(4):1855-1866.  [Content Brief]