AGR3 Protein, Human (HEK293, His)

AGR3 Protein, Human (HEK293, His) is human recombinant AG-3 with a N-terminal His tag. AG-3 Protein, Human (HEK293, His) is expressed in HEK293 cells.

AGR3 (Anterior gradient 3; AG-3), a member of the protein disulfide isomerase (PDI) family, shares high sequence homology with AG-2. AGR3 is overexpressed in breast, prostate and ovarian cancer. Combined AGR3 and acid mucopolysaccharides could serve as a diagnostic marker for well-differentiated intrahepatic cholangiocarcinoma. AGR3 expression was correlated with the level of differentiation in the serous type of ovarian cancer. AGR3 activates Wnt/β-catenin signalling and promotes the nuclear translocation of β-catenin to upregulate stemness related genes^[1].

Human

HEK293

C-6*His

Q8TD06 (I22-L166)

155465  [NCBI]

IAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSELHHHHHH

Approximately 16.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against 20 mM Tris-HCl, 150 mM NaCl, 2 mM EDTA, pH 8.5 or 20 mM Glycine-HCl, 10% Trehalose, 0.05% Tween80, pH 3.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Chi J, et al. AGR3 promotes the stemness of colorectal cancer via modulating Wnt/β-catenin signalling. Cell Signal. 2020 Jan;65:109419.  [Content Brief]