AGER Protein, Human (HEK293, His)

AGER Protein, Human (HEK293, His) is human recombinant AGER with a His tag at the C-terminus. AGER Protein, Human (HEK293, His) is expressed by mammalian expression system and the target gene encoding Ala23-Ala344 is expressed.

AGER (Advanced glycosylation end product-specific receptor), a member of the immunoglobulin superfamily of cell surface molecules, is a transmembrane signal transduction receptor with a number of ligands, including alarmins that can initiate and perpetuate immune responses. AGER naturally exists in two forms that are full-length membrane-bound and truncated (soluble). The human AGER is a highly polymorphic gene with more than 190 SNPs mapped to its locus on the 6p21.3 chromosome. AGER interacts with a broad spectrum of ligands and multiple signaling pathways, such as those activated by the high mobility group box 1 (HMGB1) protein (a non-canonical ligand of AGER). AGER serve as a mediator of both acute and chronic vascular inflammation in certain conditions such as atherosclerosis and in particular as a complication of diabetes^[1][2].

Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human AGER at 5 µg/mL (100 µL/well) can bind biotinylated advanced glycation endproducts of bovine serum albumin (AGE-BSA). The ED₅₀ for this effect is 0.9828 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human AGER at 5 µg/mL (100 µL/well) can bind biotinylated advanced glycation endproducts of bovine serum albumin (AGE-BSA) .The ED₅₀ for this effect is 0.9828 μg/mL.

Human

HEK293

C-6*His

Q15109 (A23-A344)

177  [NCBI]

AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA

Approximately 48-60 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or PBS, pH 7.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Biros E, et al. Association between the Advanced Glycosylation End Product-Specific Receptor Gene and Cardiovascular Death in Older Men. PLoS One. 2015 Jul 30;10(7):e0134475.  [Content Brief]

  [2]. Zee RY, et al. Polymorphisms in the advanced glycosylation end product-specific receptor gene and risk of incident myocardial infarction or ischemic stroke. Stroke. 2006 Jul;37(7):1686-90.  [Content Brief]