AGER Protein, Mouse (HEK293, His)

AGER proteins have multiple activities, including binding to S100 proteins, advanced glycation end products, and heparin. It is involved in cellular responses to amyloid, regulation of synaptic potentiation, and cytokine production. AGER Protein, Mouse (HEK293, His) is the recombinant mouse-derived AGER protein, expressed by HEK293 , with C-His labeled tag.

The AGER gene encodes a protein that exhibits S100 protein binding activity, advanced glycation end-product binding activity, and heparin binding activity. Involved in various processes, including cellular response to amyloid-beta, negative regulation of long-term synaptic potentiation, and positive regulation of cytokine production, AGER acts upstream of or within pathways related to induction of positive chemotaxis, negative regulation of advanced glycation end-product receptor activity, and positive regulation of macromolecule metabolic processes. Predominantly located in the extracellular space and plasma membrane, AGER is expressed across diverse structures such as the alimentary system, brain, genitourinary system, hemolymphoid system gland, and lung. Implicated in multiple diseases, including autoimmune diseases, cardiovascular system diseases, cystic fibrosis, kidney failure, and lupus nephritis, the human ortholog of AGER, known as advanced glycosylation end-product specific receptor, plays a crucial role in diverse physiological and pathological contexts. Notably, its expression is particularly enriched in the adult lung.

Immobilized Recombinant Mouse AGER Protein at 20 μg/mL (100 μL/well) can bind Biotinylated Recombinant Human HMGB1 Protein. The ED₅₀ for this effect is 0.6233-1.298 μg/mL.

• 
  Immobilized Recombinant Mouse AGER Protein at 20 μg/mL (100 μl/well) can bind Biotinylated Recombinant Human HMGB1 Protein. The ED₅₀ for this effect is 0.6233 μg/mL.

Mouse

HEK293

C-His

Q62151-1/NP_031451.2 (Q24-A342)

11596  [NCBI]

QNITARIGEPLVLSCKGAPKKPPQQLEWKLNTGRTEAWKVLSPQGGPWDSVARILPNGSLLLPATGIVDEGTFRCRATNRRGKEVKSNYRVRVYQIPGKPEIVDPASELTASVPNKVGTCVSEGSYPAGTLSWHLDGKLLIPDGKETLVKEETRRHPETGLFTLRSELTVIPTQGGTHPTFSCSFSLGLPRRRPLNTAPIQLRVREPGPPEGIQLLVEPEGGIVAPGGTVTLTCAISAQPPPQVHWIKDGAPLPLAPSPVLLLPEVGHEDEGTYSCVATHPSHGPQESPPVSIRVTETGDEGPAEGSVGESGLGTLALA

Approximately 50 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.