1. Recombinant Proteins
  2. Others
  3. AGR3 Protein, Mouse (HEK293, His)

AGR3 Protein, Mouse (HEK293, His) is a mouse recombinant Agr3 with a His tag at the C-terminus.Recombinant is produced by Mammalian expression system and the target gene encoding Ile21-Leu165 is expressed.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

AGR3 Protein, Mouse (HEK293, His) is a mouse recombinant Agr3 with a His tag at the C-terminus.Recombinant is produced by Mammalian expression system and the target gene encoding Ile21-Leu165 is expressed.

Background

Anterior gradient protein 3 (AGR3) is a homologue of the pro-oncogenic AGR2. AGR3 and AGR2 share a 71% sequence identity and lie adjacent to one another at chromosomal position 7p2. Functionally, they belong to the protein disulfide isomerases (PDIs) family, which act as endoplasmic reticulum (ER)-resident molecular foldases involved in the maintenance of cellular homeostasis. AGR3 is an ER resident protein, which is required for the regulation of ciliary beat frequency and mucociliary clearance in the airway epithelium. AGR3 was shown to interact with dystroglycan-1 (DAG-1) and metastasis-associated C4.4A protein, indicating its potential as a driver of metastasis. AGR3 is a potential promising target for anti-tumor therapy. Elevated AGR3 expression levels were reported in some cancer types, including breast, liver, prostate and ovary[1].

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q8R3W7 (I21-L165)

Gene ID
Molecular Construction
N-term
AGR3 (I21-L165)
Accession # Q8R3W7
6*His
C-term
Synonyms
rMuAgr3, His; Agr3; Anterior gradient protein 3
AA Sequence

IAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFHARKSNKPLMVIHHLEDCQYCQALKKEFAKNEEIQEMAQNDFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYTYEPQDLPMLVDNMKKALRLIQSELHHHHHH

Molecular Weight

Approximately 16-18 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filter solution of 20 mM Tris, 100 mM NaCl, 10% Glycerol, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

AGR3 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AGR3 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P7468
Quantity:
MCE Japan Authorized Agent: