AGRP Protein, Human (HEK293, His)

AGRP proteins critically regulate body weight homeostasis and feeding behavior through the central melanocortin system. As an α-melanocyte-stimulating hormone antagonist, AGRP inhibits cAMP production and antagonizes stimulation of melanocortin receptors. AGRP Protein, Human (HEK293, His) is the recombinant human-derived AGRP protein, expressed by HEK293 , with C-His labeled tag.

The AGRP protein plays a crucial role in weight homeostasis and is integral to the regulation of feeding behavior through the central melanocortin system. Functioning as an alpha melanocyte-stimulating hormone antagonist, AGRP inhibits cAMP production mediated by the stimulation of melanocortin receptors within the hypothalamus and adrenal gland. While exhibiting minimal activity with MC5R, AGRP serves as an inverse agonist for MC3R and MC4R, suppressing their constitutive activity. Moreover, AGRP promotes the endocytosis of MC3R and MC4R in an arrestin-dependent manner, underscoring its intricate involvement in modulating the activity of melanocortin receptors. The interaction of AGRP with MC3R, MC4R, and MC5R further highlights its regulatory role in the melanocortin signaling pathway, positioning it as a key player in the intricate balance of weight regulation and feeding control.

Measured by its ability to antagonize alpha-MSH-induced cAMP accumulation in HEK293 human embryonic kidney cells transfected with human Melanocortin-4 Receptor. The ED₅₀ for this effect is typically ≤0.1019 µg/mL, corresponding to a specific activity is ≥9813.543 U/mg, in the presence of 10 ng/mL of alpha-MSH(HY-P0252).

• 
  Measured by its ability to antagonize alpha-MSH-induced cAMP accumulation in HEK293 human embryonic kidney cells transfected with human Melanocortin-4 Receptor. The ED₅₀ for this effect is typically 0.1019 µg/mL，corresponding to a specific activity is 9813.543 U/mg，in the presence of 10 ng/mL of alpha -MSH.

Human

HEK293

C-His

O00253 (A21-T132)

181  [NCBI]

AQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT

Approximately 16-21 kDa

Greater than 90% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.2 or PBS, pH 7.2, 5% trehalose, 5% mannitol and 0.01% Tween80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.