1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. AGRP Protein, Human (HEK293, His)

AGRP Protein, Human (HEK293, His)

Cat. No.: HY-P75526
COA Handling Instructions

AGRP proteins critically regulate body weight homeostasis and feeding behavior through the central melanocortin system. As an α-melanocyte-stimulating hormone antagonist, AGRP inhibits cAMP production and antagonizes stimulation of melanocortin receptors. AGRP Protein, Human (HEK293, His) is the recombinant human-derived AGRP protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg $250 In-stock
100 μg $400 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

AGRP proteins critically regulate body weight homeostasis and feeding behavior through the central melanocortin system. As an α-melanocyte-stimulating hormone antagonist, AGRP inhibits cAMP production and antagonizes stimulation of melanocortin receptors. AGRP Protein, Human (HEK293, His) is the recombinant human-derived AGRP protein, expressed by HEK293 , with C-His labeled tag.

Background

The AGRP protein plays a crucial role in weight homeostasis and is integral to the regulation of feeding behavior through the central melanocortin system. Functioning as an alpha melanocyte-stimulating hormone antagonist, AGRP inhibits cAMP production mediated by the stimulation of melanocortin receptors within the hypothalamus and adrenal gland. While exhibiting minimal activity with MC5R, AGRP serves as an inverse agonist for MC3R and MC4R, suppressing their constitutive activity. Moreover, AGRP promotes the endocytosis of MC3R and MC4R in an arrestin-dependent manner, underscoring its intricate involvement in modulating the activity of melanocortin receptors. The interaction of AGRP with MC3R, MC4R, and MC5R further highlights its regulatory role in the melanocortin signaling pathway, positioning it as a key player in the intricate balance of weight regulation and feeding control.

Biological Activity

Measured by its ability to antagonize alpha-MSH-induced cAMP accumulation in HEK293 human embryonic kidney cells transfected with human Melanocortin-4 Receptor. The ED50 for this effect is typically ≤0.1019 µg/mL, corresponding to a specific activity is ≥9813.543 U/mg, in the presence of 10 ng/mL of alpha-MSH(HY-P0252).

  • Measured by its ability to antagonize alpha-MSH-induced cAMP accumulation in HEK293 human embryonic kidney cells transfected with human Melanocortin-4 Receptor. The ED50 for this effect is typically 0.1019 µg/mL,corresponding to a specific activity is 9813.543 U/mg,in the presence of 10 ng/mL of alpha -MSH.
Species

Human

Source

HEK293

Tag

C-His

Accession

O00253 (A21-T132)

Gene ID

181  [NCBI]

Molecular Construction
N-term
AGRP (A21-T132)
Accession # O00253
His
C-term
Synonyms
Agouti-related protein; AGRP; AGRT; ART
AA Sequence

AQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT

Molecular Weight

Approximately 16-21 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.2 or PBS, pH 7.2, 5% trehalose, 5% mannitol and 0.01% Tween80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

AGRP Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AGRP Protein, Human (HEK293, His)
Cat. No.:
HY-P75526
Quantity:
MCE Japan Authorized Agent: