AHSP Protein, Human

AHSP protein, a chaperone in erythroid cell development, safeguards alpha-hemoglobin, preventing harmful aggregation and precipitation. Crucial for alpha-hemoglobin stability, it modulates conditions linked to alpha-hemoglobin excess, like beta-thalassemia. AHSP forms a selective heterodimer with free alpha-hemoglobin, not binding to beta-hemoglobin or alpha(2)beta(2) hemoglobin A. This interaction prevents detrimental interactions, ensuring the proper hemoglobin component balance in erythropoiesis. AHSP Protein, Human is the recombinant human-derived AHSP protein, expressed by E. coli, with tag free. The total length of AHSP Protein, Human is 102 a.a., with molecular weight of ~12 KDa.

AHSP protein serves as a chaperone during normal erythroid cell development, safeguarding alpha-hemoglobin from harmful aggregation by preventing its precipitation. This protective function is crucial for maintaining the stability of free alpha-hemoglobin and is particularly relevant in modulating pathological conditions associated with an excess of alpha-hemoglobin, such as beta-thalassemia. AHSP exists as a monomer and forms a specific heterodimeric complex with free alpha-hemoglobin, exhibiting selectivity as it does not bind to beta-hemoglobin or the alpha(2)beta(2) hemoglobin A complex. This interaction underscores AHSP's role in preventing detrimental interactions and maintaining the proper balance of hemoglobin components during erythropoiesis.

Human

E. coli

Tag Free

Q9NZD4 (M1-S102)

51327  [NCBI]

MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS

Approximately 12 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.