AICDA Protein, Mouse (His-Myc)

AICDA Protein, Mouse (His-Myc) is an enzyme that mediates affinity maturation and facilitates DNA demethylation in germinal center (GC) B cells. AICDA Protein overexpression causes more aggressive disease in BCL2-driven murine lymphomas.

Activation-induced cytidine deaminase (AICDA), an enzyme that mediates affinity maturation and facilitates DNA demethylation in germinal center (GC) B cells, is required for DLBCL pathogenesis and linked to inferior outcome. AICDA overexpression causes more aggressive disease in BCL2-driven murine lymphomas. Besides the role of AICDA in modifying cytosine methylation during the GC reaction13, AICDA is additionally a critical source of epigenetic heterogeneity in DLBCL. AICDA-linked epigenetic heterogeneity is predominantly associated with relative loss of cytosine methylation, consistent with the known mechanism of action of AICDA in cytosine deamination. AICDA-induced epigenetic heterogeneity increases plasticity, permitting cancer cells a greater degree of population diversity and enhancing the adaptive capacity of the overall tumor^[1].

Mouse

E. coli

N-10*His;C-Myc

Q9WVE0 (M1-F198)

11628  [NCBI]

MDSLLMKQKKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSCSLDFGHLRNKSGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVAEFLRWNPNLSLRIFTARLYFCEDRKAEPEGLRRLHRAGVQIGIMTFKDYFYCWNTFVENRERTFKAWEGLHENSVRLTRQLRRILLPLYEVDDLRDAFRMLGF

Approximately 31.5 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Teater M, et, al. AICDA drives epigenetic heterogeneity and accelerates germinal center-derived lymphomagenesis. Nat Commun. 2018 Jan 15;9(1):222.  [Content Brief]