1. Recombinant Proteins
  2. Others
  3. AIF1 Protein, Human (N-His)

AIF1 Protein, Human (N-His)

Cat. No.: HY-P7488A
SDS COA Handling Instructions

The AIF1 protein is an actin-binding promoter that enhances membrane ruffling, activates RAC, and amplifies the actin-bundling activity of LCP1. This calcium-binding protein has a critical impact on RAC signaling, phagocytosis, and may contribute to macrophage function. AIF1 Protein, Human (N-His) is the recombinant human-derived AIF1 protein, expressed by E. coli , with N-His labeled tag. The total length of AIF1 Protein, Human (N-His) is 147 a.a., with molecular weight of ~19 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $57 In-stock
10 μg $160 In-stock
50 μg $490 In-stock
100 μg $820 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The AIF1 protein is an actin-binding promoter that enhances membrane ruffling, activates RAC, and amplifies the actin-bundling activity of LCP1. This calcium-binding protein has a critical impact on RAC signaling, phagocytosis, and may contribute to macrophage function. AIF1 Protein, Human (N-His) is the recombinant human-derived AIF1 protein, expressed by E. coli , with N-His labeled tag. The total length of AIF1 Protein, Human (N-His) is 147 a.a., with molecular weight of ~19 kDa.

Background

AIF1, an actin-binding protein, serves as a facilitator of membrane ruffling and RAC activation, and augments the actin-bundling activity of LCP1. This calcium-binding protein plays a crucial role in RAC signaling, phagocytosis, and potentially contributes to macrophage activation and function. AIF1 is implicated in promoting the proliferation of vascular smooth muscle cells and T-lymphocytes, as well as enhancing lymphocyte migration. Additionally, it is involved in vascular inflammation. AIF1 can exist as a homodimer (Potential) or a monomer and interacts with LCP1, indicating its participation in intricate molecular interactions governing cellular processes.

Species

Human

Source

E. coli

Tag

N-His

Accession

P55008 (M1-P147)

Gene ID

199  [NCBI]

Molecular Construction
N-term
His
AIF1 (M1-P147)
Accession # P55008
C-term
Synonyms
AIF-1; Allograft inflammatory factor 1
AA Sequence

MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP

Molecular Weight

Approximately 19 KDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01% Tween80, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

AIF1 Protein, Human (N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AIF1 Protein, Human (N-His)
Cat. No.:
HY-P7488A
Quantity:
MCE Japan Authorized Agent: