AIF1 Protein, Human (N-His)

The AIF1 protein is an actin-binding promoter that enhances membrane ruffling, activates RAC, and amplifies the actin-bundling activity of LCP1. This calcium-binding protein has a critical impact on RAC signaling, phagocytosis, and may contribute to macrophage function. AIF1 Protein, Human (N-His) is the recombinant human-derived AIF1 protein, expressed by E. coli , with N-His labeled tag. The total length of AIF1 Protein, Human (N-His) is 147 a.a., with molecular weight of ~19 kDa.

AIF1, an actin-binding protein, serves as a facilitator of membrane ruffling and RAC activation, and augments the actin-bundling activity of LCP1. This calcium-binding protein plays a crucial role in RAC signaling, phagocytosis, and potentially contributes to macrophage activation and function. AIF1 is implicated in promoting the proliferation of vascular smooth muscle cells and T-lymphocytes, as well as enhancing lymphocyte migration. Additionally, it is involved in vascular inflammation. AIF1 can exist as a homodimer (Potential) or a monomer and interacts with LCP1, indicating its participation in intricate molecular interactions governing cellular processes.

Human

E. coli

N-His

P55008 (M1-P147)

199  [NCBI]

MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP

Approximately 19 KDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01% Tween80, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.