1. Recombinant Proteins
  2. Others
  3. AIF1 Protein, Mouse (His)

AIF1 Protein, Mouse (His) is an actin-polymerizing and Rac1-activating protein that promotes vascular smooth muscle cell migration.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

AIF1 Protein, Mouse (His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

AIF1 Protein, Mouse (His) is an actin-polymerizing and Rac1-activating protein that promotes vascular smooth muscle cell migration.

Background

Allograft inflammatory factor-1 (AIF-1), which is also known as ionized calcium-binding adapter molecule 1 (Iba1), is a cytoplasmic protein with EF-hand calcium-binding domains and was first observed in the macrophages of rat heart allografts under chronic rejection. AIF-1 is highly expressed in the monocytic lineage, including macrophages and microglia, and is involved in phagocytosis and the formation of membrane ruffling through Rac1, which belongs to the Rho-family of GTPases. AIF-1 is not present in cultured human VSMCs but is induced by cytokines, and overexpression of AIF-1 results in increased VSMC growth and cell-cycle gene expression[1][2].

Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

O70200 (S2-P147)

Gene ID
Molecular Construction
N-term
6*His
AIF1 (S2-P147)
Accession # O70200
C-term
Synonyms
Aif1; Iba1Allograft inflammatory factor 1; AIF-1; Ionized calcium-binding adapter molecule 1
AA Sequence

SQSRDLQGGKAFGLLKAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHKRPTGPPAKKAISELP

Molecular Weight

Approximately 24 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm solution of PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
References

AIF1 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AIF1 Protein, Mouse (His)
Cat. No.:
HY-P72075
Quantity:
MCE Japan Authorized Agent: