AIF1 Protein, Mouse (His)

AIF1 Protein, Mouse (His) is an actin-polymerizing and Rac1-activating protein that promotes vascular smooth muscle cell migration.

Allograft inflammatory factor-1 (AIF-1), which is also known as ionized calcium-binding adapter molecule 1 (Iba1), is a cytoplasmic protein with EF-hand calcium-binding domains and was first observed in the macrophages of rat heart allografts under chronic rejection. AIF-1 is highly expressed in the monocytic lineage, including macrophages and microglia, and is involved in phagocytosis and the formation of membrane ruffling through Rac1, which belongs to the Rho-family of GTPases. AIF-1 is not present in cultured human VSMCs but is induced by cytokines, and overexpression of AIF-1 results in increased VSMC growth and cell-cycle gene expression^[1][2].

Mouse

E. coli

N-6*His

O70200 (S2-P147)

11629  [NCBI]

SQSRDLQGGKAFGLLKAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHKRPTGPPAKKAISELP

Approximately 24 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Autieri MV, et, al. AIF-1 is an actin-polymerizing and Rac1-activating protein that promotes vascular smooth muscle cell migration. Circ Res. 2003 May 30;92(10):1107-14.  [Content Brief]

  [2]. Kishikawa S, et, al. Allograft inflammatory factor 1 is a regulator of transcytosis in M cells. Nat Commun. 2017 Feb 22;8:14509.  [Content Brief]