1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Superfamily Ligands
  5. GITRL/AITRL
  6. AITRL/TNFSF18 Protein, Cynomolgus (HEK293, His)

AITRL/TNFSF18 Protein, Cynomolgus (HEK293, His)

Cat. No.: HY-P72773
SDS COA Handling Instructions Technical Support

AITRL, a type II transmembrane protein, is a ligand for glucocorticoid-induced TNFR-related protein (GITR). When AITRL binds to GITR, GITR can produce costimulatory signals that regulate T-cell proliferation and effector functions. GITR/AITRL interaction plays a role in the pathogenesis of tumor, inflammation, as well as autoimmune diseases. Besides, AITRL plays a role in endothelial cells (EC)-activation and increases STAT-1 phosphorylation and the expression of adhesion molecules (VCAM-1, ICAM-1). AITRL/TNFSF18 Protein, Cynomolgus (HEK293, His) is a recombinant cynomolgus AITRL (E74-S199) with C-terminal 6*His tag, which is expressed in HEK293.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

AITRL, a type II transmembrane protein, is a ligand for glucocorticoid-induced TNFR-related protein (GITR). When AITRL binds to GITR, GITR can produce costimulatory signals that regulate T-cell proliferation and effector functions. GITR/AITRL interaction plays a role in the pathogenesis of tumor, inflammation, as well as autoimmune diseases[1]. Besides, AITRL plays a role in endothelial cells (EC)-activation and increases STAT-1 phosphorylation and the expression of adhesion molecules (VCAM-1, ICAM-1)[2]. AITRL/TNFSF18 Protein, Cynomolgus (HEK293, His) is a recombinant cynomolgus AITRL (E74-S199) with C-terminal 6*His tag, which is expressed in HEK293.

Background

GITRL (AITRL), a type II transmembrane protein, is a ligand for glucocorticoid-induced TNFR-related protein (GITR). GITR, a member of the TNFR superfamily, is expressed in T cells, natural killer cells and some myeloid cells. And GITRL is mainly expressed on antigen presenting cells (B cells, dendritic cells), macrophages and endothelial cells (ECs)[1].
When GITRL binds to GITR, GITR can produce costimulatory signals that regulate T-cell proliferation and effector functions. The interaction stimulates proliferation and cytokine production of both CD4+ Teff and Treg cells, and drives antitumor activity of CD8+ T cells[3]. Besides, GITRL plays a role in EC-activation and promotes adhesion in both mice and humans, which increases STAT-1 phosphorylation and the augmented expression of adhesion molecules such as VCAM-1 and ICAM-1[2].
GITR/GITRL interaction plays a role in the pathogenesis of tumor, inflammation, as well as autoimmune diseases[1].

In Vitro

AITRL (human, 48 h) reduces the suppressive capacity of MDSCs on CD4+ T cells (MDSCs induced from healthy donors)[5].

Species

Cynomolgus

Source

HEK293

Tag

C-6*His

Accession

A0A2K5UCD9 (E74-S199)

Gene ID
Molecular Construction
N-term
AITRL (E74-S199)
Accession # A0A2K5UCD9
6*His
C-term
Synonyms
Tumor necrosis factor ligand superfamily member 18; AITRL; hGITRL; TNFSF18; TL6
AA Sequence

ETAKEPCMAKFGPLPSKWQMASSQPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEYQVLKNNTYWGIILLANPQFIS

Molecular Weight

15-20 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

AITRL/TNFSF18 Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AITRL/TNFSF18 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P72773
Quantity:
MCE Japan Authorized Agent: