1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Superfamily Ligands
  5. GITRL/AITRL
  6. AITRL/TNFSF18 Protein, Mouse

AITRL, a type II transmembrane protein, is a ligand for glucocorticoid-induced TNFR-related protein (GITR). When AITRL binds to GITR, GITR can produce costimulatory signals that regulate T-cell proliferation and effector functions. GITR/AITRL interaction plays a role in the pathogenesis of tumor, inflammation, as well as autoimmune diseases. Besides, AITRL plays a role in endothelial cells (EC)-activation and increases STAT-1 phosphorylation and the expression of adhesion molecules (VCAM-1, ICAM-1). AITRL/TNFSF18 Protein, Mouse is a recombinant mouse AITRL (T47-S173) without tag, which is expressed in E.coli.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE AITRL/TNFSF18 Protein, Mouse

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

AITRL, a type II transmembrane protein, is a ligand for glucocorticoid-induced TNFR-related protein (GITR). When AITRL binds to GITR, GITR can produce costimulatory signals that regulate T-cell proliferation and effector functions. GITR/AITRL interaction plays a role in the pathogenesis of tumor, inflammation, as well as autoimmune diseases[1]. Besides, AITRL plays a role in endothelial cells (EC)-activation and increases STAT-1 phosphorylation and the expression of adhesion molecules (VCAM-1, ICAM-1)[2]. AITRL/TNFSF18 Protein, Mouse is a recombinant mouse AITRL (T47-S173) without tag, which is expressed in E.coli.

Background

GITRL (AITRL), a type II transmembrane protein, is a ligand for glucocorticoid-induced TNFR-related protein (GITR). GITR, a member of the TNFR superfamily, is expressed in T cells, natural killer cells and some myeloid cells[1]. And murine GITRL has been detected on dendritic cells (DCs), monocytes, macrophages, B cells, endothelial cells, osteoclasts, and microglia cells[4].
When GITRL binds to GITR, GITR can produce costimulatory signals that regulate T-cell proliferation and effector functions. The interaction stimulates proliferation and cytokine production of both CD4+ Teff and Treg cells, and drives antitumor activity of CD8+ T cells[3]. Besides, GITRL plays a role in EC-activation and promotes adhesion in both mice and humans, which increases STAT-1 phosphorylation and the augmented expression of adhesion molecules such as VCAM-1 and ICAM-1[2]. Mouse GITRL can activate signal transduction, including inducing a tolerogenic effect in DCs and pro-inflammatory stimuli in macrophages[7].
Mouse GITRL shares < 55% common aa identity with human. Murine GITRL exists as a dimer[4] GITR/GITRL interaction plays a role in the pathogenesis of tumor, inflammation, as well as autoimmune diseases[1]

In Vitro

AITRL (mouse, 5 μg/mL, 48 h) promotes the maturation of myeloid-derived suppressor cells (MDSCs) isolated from ESS mice[5].
AITRL (mouse, 2 μg/mL, 72 h) provides moderate costimulation to Treg cell proliferation[6].

In Vivo

AITRL (mouse, 2 mg/kg, i.v.) attenuates the suppressive effect of MDSCs in ESS mice[5].

Biological Activity

The ED50 is <5 ng/mL as measured by PMBC, corresponding to a specific activity of >2 × 105 units/mg.

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

Q7TS55 (T47-S173)

Gene ID
Molecular Construction
N-term
AITRL (T47-S173)
Accession # Q7TS55
C-term
Synonyms
rMuActivation-inducible TNF-related Ligand/AITRL; TNFSF18; GITRL; TL-6
AA Sequence

TAIESCMVKFELSSSKWHMTSPKPHCVNTTSDGKLKILQSGTYLIYGQVIPVDKKYIKDNAPFVVQIYKKNDVLQTLMNDFQILPIGGVYELHAGDNIYLKFNSKDHIQKTNTYWGIILMPDLPFIS

Molecular Weight

Approximately 14.5 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

AITRL/TNFSF18 Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AITRL/TNFSF18 Protein, Mouse
Cat. No.:
HY-P7319
Quantity:
MCE Japan Authorized Agent: