AK1 Protein, Human (His-SUMO)

The AK1 protein contributes to cellular energy dynamics by catalyzing the reversible transfer of terminal phosphate groups between ATP and AMP. In addition to its primary role, AK1 exhibits nucleoside diphosphate kinase activity, utilizing ATP or GTP as a phosphate donor to generate ATP, CTP, GTP, UTP, dATP, dCTP, dGTP, and dTTP. AK1 Protein, Human (His-SUMO) is the recombinant human-derived AK1 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag. The total length of AK1 Protein, Human (His-SUMO) is 194 a.a., with molecular weight of 37.6 kDa.

Adenylate Kinase 1 (AK1) is a versatile enzyme that plays a crucial role in cellular energy metabolism. It catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP, a fundamental step in maintaining adenylate pools and cellular energy homeostasis. In addition to its canonical role, AK1 exhibits nucleoside diphosphate kinase activity, enabling the production of various nucleoside triphosphates (ATP, CTP, GTP, UTP, dATP, dCTP, dGTP, and dTTP) from their corresponding diphosphate substrates, utilizing either ATP or GTP as a phosphate donor. Furthermore, AK1 displays a lower-rate catalysis of the synthesis of thiamine triphosphate (ThTP) from thiamine diphosphate (ThDP) and ADP, indicating a potential involvement in thiamine metabolism. The multifunctionality of AK1 highlights its importance in cellular energy regulation and nucleotide biosynthesis.

Human

E. coli

N-SUMO;N-6*His

P00568 (M1-K194)

203  [NCBI]

MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK

37.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.