AK3 Protein, Human (Myc, His)

AK3 Protein, Human (Myc, His) is a mitochondrial protein and is localized in the mitochondrial matrix.

Adenylate kinase (hereinafter referred to as AK) catalyzes a reversible high-energy phosphoryl transfer reaction between adenine nucleotides. So far, six AK isozymes, AK1, AK2, AK3, AK4, AK5, and AK6, were identified. AK3 is expressed in all tissues except for red blood cells indicating that AK3 gene is a housekeeping-type gene. AK3 catalyzes 1 GDP or ADP molecule formation or the reverse reaction using GTP, not ATP, as a substrate for phosphate donation. This AK3 generates GDP and ADP using GTP produced by phosphorylation in the citric acid cycle at substrate level and AMP that exists in the matrix, respectively, and the generated GDP is utilizedin the next cycle of the citric acid cycle. while the ADP is utilized as a substrate of mitochondrial ATP synthetase^[1].

Human

E. coli

N-His;C-Myc

Q9UIJ7-1 (M1-P227)

50808  [NCBI]

MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP

Approximately 32.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.