1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. AK3 Protein, Human (Myc, His)

AK3 Protein, Human (Myc, His)

Cat. No.: HY-P71645
Handling Instructions

AK3 Protein, Human (Myc, His) is a mitochondrial protein and is localized in the mitochondrial matrix.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

AK3 Protein, Human (Myc, His) is a mitochondrial protein and is localized in the mitochondrial matrix.

Background

Adenylate kinase (hereinafter referred to as AK) catalyzes a reversible high-energy phosphoryl transfer reaction between adenine nucleotides. So far, six AK isozymes, AK1, AK2, AK3, AK4, AK5, and AK6, were identified. AK3 is expressed in all tissues except for red blood cells indicating that AK3 gene is a housekeeping-type gene. AK3 catalyzes 1 GDP or ADP molecule formation or the reverse reaction using GTP, not ATP, as a substrate for phosphate donation. This AK3 generates GDP and ADP using GTP produced by phosphorylation in the citric acid cycle at substrate level and AMP that exists in the matrix, respectively, and the generated GDP is utilizedin the next cycle of the citric acid cycle. while the ADP is utilized as a substrate of mitochondrial ATP synthetase[1].

Species

Human

Source

E. coli

Tag

N-His;C-Myc

Accession

Q9UIJ7-1 (M1-P227)

Gene ID
Molecular Construction
N-term
10*His
AK3 (M1-P227)
Accession # Q9UIJ7-1
C-term
Synonyms
Adenylate kinase 3 alpha-like 1; Adenylate kinase 3; Adenylate kinase 3, formerly; adenylate kinase 6, adenylate kinase 3 like 1; AK 3; mitochondrial
AA Sequence

MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP

Molecular Weight

Approximately 32.6 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

AK3 Protein, Human (Myc, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AK3 Protein, Human (Myc, His)
Cat. No.:
HY-P71645
Quantity:
MCE Japan Authorized Agent: