AKR1C2 Protein, Human (His)

AKR1C2 protein: Cytoplasmic aldehyde-keto reductase, which uses NADH and NADPH to reduce ketosteroids to hydroxysteroids. AKR1C2 Protein, Human (His) is the recombinant human-derived AKR1C2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of AKR1C2 Protein, Human (His) is 323 a.a., with molecular weight of ~38 kDa.

AKR1C2 Protein is a cytosolic aldo-keto reductase that plays a pivotal role in catalyzing the NADH and NADPH-dependent reduction of ketosteroids to hydroxysteroids. This enzyme exhibits a likely reductase function in vivo, as evidenced by the inhibition of its oxidase activity in vitro by physiological concentrations of NADPH. AKR1C2 displays a broad positional specificity, acting on positions 3, 17, and 20 of steroids, thereby regulating the metabolism of hormones such as estrogens and androgens. Collaborating with 5-alpha/5-beta-steroid reductases, it contributes to the conversion of steroid hormones into 3-alpha/5-alpha and 3-alpha/5-beta-tetrahydrosteroids. Furthermore, AKR1C2 catalyzes the inactivation of the potent androgen 5-alpha-dihydrotestosterone (5-alpha-DHT) to 5-alpha-androstane-3-alpha,17-beta-diol (3-alpha-diol). Specifically, it is capable of producing 17beta-hydroxy-5alpha-androstan-3-one/5alphaDHT and may also reduce conjugated steroids, such as 5alpha-dihydrotestosterone sulfate. Additionally, the protein exhibits an affinity for bile acids, further emphasizing its involvement in diverse metabolic pathways.

Measured by its ability to oxidize S-1-indanol in the presence of NADP+ that incubate at roomtemperature in kinetic mode for 5 minutes. The specific activity is 54.55 pmol/min/µg.

Human

E. coli

N-6*His

P52895 (M1-Y323)

1646  [NCBI]

MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY

Approximately 38 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.