ALDH1A2 Protein, Human (His)

ALDH1A2 Protein, Human (His) is a human recombinant ALDH1A2 with a N-terminal His tag produced in E. coli. ALDH1A2 Protein, Human (His) expresses the target gene encoding Met1-Ser518.

The aldehyde dehydrogenase 1 (ALDH1) family comprises major enzymes that produce retinoic acid (RA) via the oxidation of all-trans retinal and 9-cis-retinal. The ALDH1A subfamily consists of three members, ALDH1A1, ALDH1A2, and ALDH1A3. ALDH1A2 is a rate-limiting enzyme involved in the cellular synthesis of retinoic acid, which has prodifferentiation properties. ALDH1A2 is a candidate tumor suppressor. Low ALDH1A2 expression was associated with an unfavorable prognosis in head and neck squamous cell carcinoma. ALDH1A2 suppresses epithelial ovarian cancer cell proliferation and migration by downregulating STAT3^[1][2].

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-6*His

O94788 (M1-S518)

8854  [NCBI]

HHHHHHMTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS

50-65 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filter solution of 20 mM Tris-HCl, 150 mM NaCl, 20% Glycerol, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Choi JA, et al. ALDH1A2 Is a Candidate Tumor Suppressor Gene in Ovarian Cancer. Cancers (Basel). 2019 Oct 14;11(10). pii: E1553.  [Content Brief]

  [2]. Wang Y, et al. ALDH1A2 suppresses epithelial ovarian cancer cell proliferation and migration by downregulating STAT3. Onco Targets Ther. 2018 Jan 31;11:599-608.  [Content Brief]