1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. ALDH1A2 Protein, Human (P.pastoris, His)

The ALDH1A2 protein catalyzes the NAD-dependent oxidation of aldehyde substrates, including all-trans -retinal and all-trans 13,14-dihydroretinal. ALDH1A2 Protein, Human (P.pastoris, His) is the recombinant human-derived ALDH1A2 protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of ALDH1A2 Protein, Human (P.pastoris, His) is 518 a.a., with molecular weight of 58.7 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The ALDH1A2 protein catalyzes the NAD-dependent oxidation of aldehyde substrates, including all-trans -retinal and all-trans 13,14-dihydroretinal. ALDH1A2 Protein, Human (P.pastoris, His) is the recombinant human-derived ALDH1A2 protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of ALDH1A2 Protein, Human (P.pastoris, His) is 518 a.a., with molecular weight of 58.7 kDa.

Background

ALDH1A2 protein plays a pivotal role in the NAD-dependent oxidation of various aldehyde substrates, such as all-trans-retinal and all-trans-13,14-dihydroretinal, converting them into their corresponding carboxylic acids, namely all-trans-retinoate and all-trans-13,14-dihydroretinoate. This enzymatic activity is essential for retinoate signaling, a process critical for the transcriptional control of numerous genes and notably crucial for the initiation of meiosis in both male and female organisms. ALDH1A2 can recognize retinal as a substrate, whether in its free form or when bound to cellular retinol-binding protein. While displaying the capability to metabolize octanal and decanal, ALDH1A2 exhibits only minimal activity with benzaldehyde, acetaldehyde, and propanal. Interestingly, it completely lacks activity with citral.

Species

Human

Source

P. pastoris

Tag

N-6*His

Accession

O94788 (M1-S518)

Gene ID
Molecular Construction
N-term
6*His
ALDH1A2 (M1-S518)
Accession # O94788
C-term
Synonyms
rHuAldehyde Dehydrogenase 1-A2, His ; ALDH-1A2; Aldehyde Dehydrogenase 1-A2
AA Sequence

MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS

Molecular Weight

58.7 kDa

Purity

Greater than 90 % as determined by SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

ALDH1A2 Protein, Human (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ALDH1A2 Protein, Human (P.pastoris, His)
Cat. No.:
HY-P700646
Quantity:
MCE Japan Authorized Agent: