2. Recombinant Proteins
  3. Enzymes & Regulators
  4. Phosphatase
  5. Alkaline Phosphatase
  6. Alkaline Phosphatase/ALPG Protein, Rat (HEK293, His)

Alkaline Phosphatase/ALPG Protein, Rat (HEK293, His)

Cat. No.: HY-P702581
COA Handling Instructions

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg $160 In-stock
50 μg $305 In-stock
100 μg $490 In-stock
> 100 μg   Get quote  
or Bulk Inquiry

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Technical Parameters

  • Properties

  • Documentation

Species

Rat
Source

HEK293
Tag

C-His
Accession

F1M8U7 (V22-P510)
Gene ID

/
Synonyms
Alkaline Phosphatase; ALP-1; Alkaline phosphatase, placental-like; GCAP; PLAP-like; ALPG; ALPPL; ALPPL2
AA Sequence

VIPVEEENPAFWNQKAKEALDVAKKLKPIRTSAKNLIIFLGDGMGVPTVTATRILKGQLGGHLGPETPLAMDHFPFTALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGNEVFSVMHRAKKAGKSVGVVTTTSVQHASPAGTYAHTVNCDWYSDAHMATAALQEGCKDIAMQLISNMDIDVILGGGRKFMFPKGTPDPEYSGNRAQSGTRLDGQNLVQKWLAKHQGARYVWNRTELIQASQDSAVTHLMGLFEPNDMKYDIYRDPTQDPSLAEMTEVAVHLLSRNPKGFYLFVEGGHIDHGHHESIAYRALTEAVMFDSAVDKANKLTSEKDTMILVTADHSHVFSFGGYVPRGTSIFGLGASFNALDGRPFTSILYGNGPGYKLEKGTRPDVTDKESRDPKYRQQAAVPLSSETHSGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPAGRSSAVSP

Molecular Weight

55-70 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.
Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Shipping

Room temperature in continental US; may vary elsewhere.
Documentation

COA (220 KB)

Handling Instructions (2659 KB)

Alkaline Phosphatase/ALPG Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Alkaline Phosphatase/ALPG Protein, Rat (HEK293, His)
Cat. No.:
HY-P702581
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.