2. Recombinant Proteins
  3. Enzymes & Regulators
  4. Phosphatase
  5. Alkaline Phosphatase
  6. Alkaline Phosphatase/ALPG Protein, Rat (HEK293, His)

Alkaline Phosphatase/ALPG Protein, Rat (HEK293, His)

Cat. No.: HY-P702581
SDS COA Handling Instructions Technical Support

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  
or Bulk Inquiry

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Technical Parameters

  • Properties

  • Documentation

Species

Rat
Source

HEK293
Tag

C-His
Accession

F1M8U7 (V22-P510)
Gene ID

/
Synonyms
Alkaline Phosphatase; ALP-1; Alkaline phosphatase, placental-like; GCAP; PLAP-like; ALPG; ALPPL; ALPPL2
AA Sequence

VIPVEEENPAFWNQKAKEALDVAKKLKPIRTSAKNLIIFLGDGMGVPTVTATRILKGQLGGHLGPETPLAMDHFPFTALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGNEVFSVMHRAKKAGKSVGVVTTTSVQHASPAGTYAHTVNCDWYSDAHMATAALQEGCKDIAMQLISNMDIDVILGGGRKFMFPKGTPDPEYSGNRAQSGTRLDGQNLVQKWLAKHQGARYVWNRTELIQASQDSAVTHLMGLFEPNDMKYDIYRDPTQDPSLAEMTEVAVHLLSRNPKGFYLFVEGGHIDHGHHESIAYRALTEAVMFDSAVDKANKLTSEKDTMILVTADHSHVFSFGGYVPRGTSIFGLGASFNALDGRPFTSILYGNGPGYKLEKGTRPDVTDKESRDPKYRQQAAVPLSSETHSGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPAGRSSAVSP

Molecular Weight

55-70 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.
Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Shipping

Room temperature in continental US; may vary elsewhere.
Documentation
SDS (251 KB)

COA (220 KB)

Handling Instructions (2659 KB)

Alkaline Phosphatase/ALPG Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Alkaline Phosphatase/ALPG Protein, Rat (HEK293, His)
Cat. No.:
HY-P702581
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (251 KB) Français - FR (251 KB) Deutsch - DE (251 KB) Norwegian - NO (251 KB) Español - ES (251 KB) Swedish - SV (251 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.