1. Recombinant Proteins
  2. Others
  3. Alpha 1-Microglobulin Protein, Human (HEK293, His)

Alpha 1-Microglobulin Protein, Human (HEK293, His)

Cat. No.: HY-P7489
COA Handling Instructions

Alpha 1-Microglobulin Protein, Human (HEK293, His) is a recombinant human macroglobulin with His tag produced by HEK293-expressed. Alpha 1-Microglobulin is a lipocalin with immunosuppressive properties.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $90 In-stock
50 μg $250 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Alpha 1-Microglobulin Protein, Human (HEK293, His) is a recombinant human macroglobulin with His tag produced by HEK293-expressed. Alpha 1-Microglobulin is a lipocalin with immunosuppressive properties[1].

Background

Alpha 1-Microglobulin has a yellow-brown color and is size and charge heterogeneous. This is caused by an array of small chromophore prosthetic groups, attached to amino acid residues at the entrance of the lipocalin pocket. A gene in the lipocalin cluster encodes Alpha 1-Microglobulin together with a Kunitz-type proteinase inhibitor, bikunin. The gene is translated into the Alpha 1-Microglobulin-bikunin precursor, which is subsequently cleaved and the two proteins secreted to the blood separately. Alpha 1-Microglobulin is found in blood and in connective tissue in most organs[1].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P02760 (G20-V203)

Gene ID

259  [NCBI]

Molecular Construction
N-term
AMBP (G20-V203)
Accession # P02760
6*His
C-term
Synonyms
rHuAlpha 1-Microglobulin, His; AMBP; Alpha 1-Microglobulin
AA Sequence

GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVHHHHHH

Molecular Weight

Approximately 33.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Alpha 1-Microglobulin Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Alpha 1-Microglobulin Protein, Human (HEK293, His)
Cat. No.:
HY-P7489
Quantity:
MCE Japan Authorized Agent: