1. Recombinant Proteins
  2. Others
  3. Alpha-crystallin A chain/CRYAA Protein, Human (His)

Alpha-crystallin A chain/CRYAA Protein, Human (His)

Cat. No.: HY-P7872
Handling Instructions Technical Support

Alpha-crystallin A chain/CRYAA Protein, Human (His) is a recombinant Alpha-crystallin A chain protein with a His tag. Alpha-crystallin A chain/CRYAA is a small heat shock protein and molecular chaperone that prevents nonspecific aggregation of denaturing proteins. Several point mutations in the alphaA-crystallin gene cause congenital human cataracts by unknown mechanisms.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Alpha-crystallin A chain/CRYAA Protein, Human (His) is a recombinant Alpha-crystallin A chain protein with a His tag. Alpha-crystallin A chain/CRYAA is a small heat shock protein and molecular chaperone that prevents nonspecific aggregation of denaturing proteins. Several point mutations in the alphaA-crystallin gene cause congenital human cataracts by unknown mechanisms[1].

Background

Alpha-crystallin A chain/CRYAA Protein is a member of the small heat shock protein family that includes 10 proteins in humans characterized by a conserved-crystallin domain of ~90 amino acids in their C-terminal region. Point mutations in small heat shock protein genes are associated with pathological conditions such as cataracts and desmin-related myopathy[1].

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant CRYAA Human is used at 2 μg/mL can bind anti-CRYAA antibody. The ED50 for this effect is 1.405 μg/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant CRYAA Human is used at 2 μg/mL can bind anti-CRYAA antibody. The ED50 for this effect is 1.405 μg/mL.
Species

Human

Source

E. coli

Tag

C-6*His

Accession

P02489 (M1-S173)

Gene ID
Molecular Construction
N-term
CRYAA (M1-S173)
Accession # P02489
6*His
C-term
Synonyms
rHuAlpha-crystallin A chain/CRYAA, His; Alpha-Crystallin A Chain; Heat Shock Protein Beta-4; HspB4; Alpha-Crystallin A Chain; Short Form; CRYAA; CRYA1; HSPB4
AA Sequence

MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS

Molecular Weight

Approximately 20-23 kDa

Purity
  • Measured by its binding ability in a functional ELISA. When Recombinant CRYAA Human is used at 2 μg/mL can bind anti-CRYAA antibody. The ED50 for this effect is 1.405 μg/mL.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, 2 mM EDTA, pH 8.0 or PBS, pH 6.5, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Alpha-crystallin A chain/CRYAA Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Alpha-crystallin A chain/CRYAA Protein, Human (His)
Cat. No.:
HY-P7872
Quantity:
MCE Japan Authorized Agent: