1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3) Phosphatase
  4. Alkaline Phosphatase
  5. ALPI Protein, Rat (HEK293, His)

ALPI Protein, Rat (HEK293, His)

Cat. No.: HY-P700395
COA Handling Instructions

The ALPI protein, an alkaline phosphatase enzyme, hydrolyzes phosphate compounds, demonstrating enzymatic activity in breaking down different phosphate molecules.ALPI Protein, Rat (HEK293, His) is the recombinant rat-derived ALPI protein, expressed by HEK293 , with N-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg $175 In-stock
50 μg $350 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The ALPI protein, an alkaline phosphatase enzyme, hydrolyzes phosphate compounds, demonstrating enzymatic activity in breaking down different phosphate molecules.ALPI Protein, Rat (HEK293, His) is the recombinant rat-derived ALPI protein, expressed by HEK293 , with N-10*His labeled tag.

Background

ALPI protein is an alkaline phosphatase enzyme that possesses the capability to hydrolyze a range of phosphate compounds. It exhibits the ability to break down various phosphate molecules through its enzymatic activity.

Biological Activity

Unit Definition: One unit is defined as the amount of enzyme required to cleave 1 nmol p-nitro-pbenylphosphate (pNPP), in 1 minute at 37°C, pH 10.0. The specifc activity is 10000 U/mg.

Species

Rat

Source

HEK293

Tag

N-10*His

Accession

P15693 (V21-N511)

Gene ID
Molecular Construction
N-term
10*His
ALPI (V21-N511)
Accession # P15693
C-term
Synonyms
Intestinal-type alkaline phosphatase; IAP; ALPI; Alkaline Phosphatase
AA Sequence

VIPVEEENPVFWNQKAKEALDVAKKLQPIQTSAKNLILFLGDGMGVPTVTATRILKGQLGGHLGPETPLAMDHFPFTALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGNEVFSVMHRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRDWYSDADMPSSALQEGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPGDSDQSGVRLDSRNLVEEWLAKYQGTRYVWNREQLMQASQDPAVTRLMGLFEPTEMKYDVNRNASADPSLAEMTEVAVRLLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLTLITADHSHVFAFGGYTLRGTSIFGLAPLNAQDGKSYTSILYGNGPGYVLNSGNRPNVTDAESGDVNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPADENRPTTPVQN

Molecular Weight

55.9 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ALPI Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ALPI Protein, Rat (HEK293, His)
Cat. No.:
HY-P700395
Quantity:
MCE Japan Authorized Agent: