AMELX Protein, Human (His-SUMO)

AMELX Protein plays a central role in biomineralization, shaping crystallite formation during the secretory stage of tooth enamel development. Its pivotal function extends to structurally organizing and mineralizing developing enamel, emphasizing its significance in dental tissue architecture. Interactions with KRT5 suggest its involvement in molecular networks contributing to the orchestrated development and mineralization of tooth enamel. AMELX Protein, Human (His-SUMO) is the recombinant human-derived AMELX protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag. The total length of AMELX Protein, Human (His-SUMO) is 175 a.a., with molecular weight of ~35.9 kDa.

AMELX takes center stage in the intricate process of biomineralization, exerting its influence on the formation of crystallites during the secretory stage of tooth enamel development. Its pivotal role extends to the structural organization and mineralization of developing enamel, emphasizing its significance in shaping the intricate architecture of dental tissues. Furthermore, AMELX engages in interactions with KRT5, suggesting its involvement in intricate molecular networks that contribute to the orchestrated development and mineralization of tooth enamel.

Human

E. coli

N-SUMO;N-6*His

Q99217 (17M-191D)

265  [NCBI]

MPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD

Approximately 35.9 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.