Aminopeptidase P2 Protein, Human (HEK293, His)

Aminopeptidase P2 Protein, Human (HEK293, His), a recombinant human Aminopeptidase P2 produced in HEK293 cells, has a His tag at the C-terminus. Aminopeptidase P2 is an aminoacylproline hydrolase that specifically removes the N-terminal amino acid from peptides with a penultimate prolyl residue^[1].

Aminopeptidase P2 (XPNPEP2; APP2) is membranebound. Aminopeptidase P2 is a receptor for TMTP1 tumor-homing peptide. APP2 has a much more restricted substrate speciWcity; it fails to hydrolyze XPro dipeptides and cleaves X-Pro-Y- peptides poorly when X is Pro or Gly or when Y is an amino acid with a bulky side chain^[1][2].

Human

HEK293

C-6*His

O43895 (H22-A650)

7512  [NCBI]

HTKPVDLGGQDVRNCSTNPPYLPVTVVNTTMSLTALRQQMQTQNLSAYIIPGTDAHMNEYIGQHDERRAWITGFTGSAGTAVVTMKKAAVWTDSRYWTQAERQMDCNWELHKEVGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTWQEKVSGVRSQMQKHQKVPTAVLLSALEETAWLFNLRASDIPYNPFFYSYTLLTDSSIRLFANKSRFSSETLSYLNSSCTGPMCVQIEDYSQVRDSIQAYSLGDVRIWIGTSYTMYGIYEMIPKEKLVTDTYSPVMMTKAVKNSKEQALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFSSGPSFETISASGLNAALAHYSPTKELNRKLSSDEMYLLDSGGQYWDGTTDITRTVHWGTPSAFQKEAYTRVLIGNIDLSRLIFPAATSGRMVEAFARRALWDAGLNYGHGTGHGIGNFLCVHEWPVGFQSNNIAMAKGMFTSIEPGYYKDGEFGIRLEDVALVVEAKTKYPGSYLTFEVVSFVPYDRNLIDVSLLSPEHLQYLNRYYQTIREKVGPELQRRQLLEEFEWLQQHTEPLAAHHHHHH

Approximately 78.0 kDa

Greater than 80% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Erşahin C, et al. Aminopeptidase P isozyme expression in human tissues and peripheral blood mononuclear cell fractions. Arch Biochem Biophys. 2005 Mar 15;435(2):303-10.  [Content Brief]

  [2]. Li F, et al. XPNPEP2 is associated with lymph node metastasis in prostate cancer patients. Sci Rep. 2019 Jul 11;9(1):10078.  [Content Brief]