Amphiregulin Protein, Human

Amphiregulin Protein, an EGFR ligand, serves as an autocrine growth factor and mitogen for various cells, including astrocytes, Schwann cells, and fibroblasts. It promotes cellular proliferation and interacts with CNIH in its immature precursor stage. Amphiregulin's EGFR activation underscores its role in essential cellular processes, emphasizing its significance as a regulator of cell growth and function in diverse cell types. Amphiregulin Protein, Human is the recombinant human-derived Amphiregulin protein, expressed by E. coli , with tag free.

Amphiregulin, a ligand for the EGF receptor (EGFR), acts as an autocrine growth factor and mitogen for diverse target cells, including astrocytes, Schwann cells, and fibroblasts. Its role extends to promoting cellular proliferation, and it engages in interactions with CNIH during its immature precursor stage. Amphiregulin's ability to activate EGFR suggests its involvement in key cellular processes and highlights its significance as a regulator of cell growth and function in various cell types.

Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED₅₀ for this effect is ≤124.1 ng/mL, corresponding to a specific activity is ≥8058 U/mg.

• 
  Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED₅₀ for this effect is 124.1 ng/mL，corresponding to a specific activity is 8058 U/mg.

Human

E. coli

Tag Free

P15514 (S101-K198)

374  [NCBI]

SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK

14-17 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.