2. Recombinant Proteins
  3. Enzymes & Regulators
  4. Hydrolases (EC 3)
  5. AMY2A Protein, Rhesus Macaque (HEK293, His)

AMY2A Protein, Rhesus Macaque (HEK293, His)

Cat. No.: HY-P76724
Handling Instructions

AMY2B is a hydrolytic enzyme secreted by the pancreas that can hydrolyze α- 1,4-glycosidic bond, belonging to α- Members of the amylase family. AMY2B plays an important role in digesting dietary starch, and inhibiting AMY2B can lead to a decrease in postprandial blood sugar levels. Therefore, by regulating α- Amylase activity to control blood sugar level has therapeutic significance for diabetes, obesity and other diseases. AMY2A Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived AMY2A protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

AMY2B is a hydrolytic enzyme secreted by the pancreas that can hydrolyze α- 1,4-glycosidic bond, belonging to α- Members of the amylase family. AMY2B plays an important role in digesting dietary starch, and inhibiting AMY2B can lead to a decrease in postprandial blood sugar levels. Therefore, by regulating α- Amylase activity to control blood sugar level has therapeutic significance for diabetes, obesity and other diseases. AMY2A Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived AMY2A protein, expressed by HEK293 , with C-His labeled tag.
Background

AMY2B is a hydrolytic enzyme secreted by the pancreas that can hydrolyze α- 1,4-glycosidic bond, belonging to α- Members of the amylase family. AMY2B plays an important role in digesting dietary starch, and inhibiting AMY2B can lead to a decrease in postprandial blood sugar levels. Therefore, by regulating α- Amylase activity to control blood sugar level has therapeutic significance for diabetes, obesity and other diseases[1][2].
Species

Rhesus Macaque
Source

HEK293
Tag

C-10*His
Accession

H9EX43 (Q16-L511)
Gene ID
Molecular Construction
N-term
AMY2A (Q16-L511)
Accession # H9EX43
His
C-term
Synonyms
Pancreatic alpha-amylase; PA; 1,4-alpha-D-glucan glucanohydrolase
AA Sequence

QYSPNTQQGRTSIVHLFEWRWADIALECERYLAPKGFGGVQVSPPNENVAIHNPSRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTSSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSEIAEYMNKLIDMGVAGFRLDASKHMWPGDIKAVLDKLHNLNSNWFPQGSKPFIYQEVIDLGGEPIKSSEYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRNFQNGKDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVAFRNVVDGQPFTNWYDNGSNQVAFGRGNKGFIVFNNDDWSFSSTLQTGLPAGTYCDVISGDKIDGNCTGIKIYVSNDGKAQFSISNSAEDPFIAIHVESKL

Molecular Weight

Approximately 56-72 kDa due to the glycosylation.
Purity

Greater than 95% as determined by reducing SDS-PAGE
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

AMY2A Protein, Rhesus Macaque (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AMY2A Protein, Rhesus Macaque (HEK293, His)
Cat. No.:
HY-P76724
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.