Angiopoietin-2 Protein, Human (CHO, His)

Angiopoietin-2 (ANGPT2) protein competes with ANGPT1 for TEK/TIE2 binding, modulates ANGPT1 signaling and induces TEK/TIE2 phosphorylation even in the absence of ANGPT1. In the absence of angiogenic stimulation, ANGPT2 disrupts cell-matrix contacts, potentially triggering endothelial cell apoptosis and vessel regression. Angiopoietin-2 Protein, Human (CHO, His) is the recombinant human-derived Angiopoietin-2 protein, expressed by CHO , with C-6*His labeled tag. The total length of Angiopoietin-2 Protein, Human (CHO, His) is 478 a.a., with molecular weight of ~62.6 kDa.

The Angiopoietin-2 (ANGPT2) protein binds to TEK/TIE2, competing for the ANGPT1 binding site and thereby modulating ANGPT1 signaling. This interaction can induce the tyrosine phosphorylation of TEK/TIE2 even in the absence of ANGPT1. In the absence of angiogenic inducers, such as VEGF, ANGPT2's action leads to the loosening of cell-matrix contacts, potentially inducing endothelial cell apoptosis and consequent vascular regression. However, in the presence of VEGF, ANGPT2 collaborates to facilitate endothelial cell migration and proliferation, acting as a permissive angiogenic signal. Furthermore, ANGPT2 is involved in the regulation of lymphangiogenesis. The protein also interacts with TEK/TIE2, competing for the same binding site as ANGPT1, and additionally interacts with ITGA5, contributing to its multifaceted role in angiogenesis and vascular regulation.

Immobilized Angiopoietin-2 Protein, Human (CHO, His) at 2 μg/mL (100 μl/well) can bind human TIE2-Fc and the EC₅₀ is 80-480 ng/mL.

Human

CHO

C-6*His

O15123-1 (Y19-F496)

285  [NCBI]

MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Approximately 62.6 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM MOPS, 150 mM NaCl, 0.05% CHAPS, pH 7.0. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.