ANGPTL2/Angiopoietin-like 2 Protein, Mouse (HEK293, Fc)

ANGPTL2/Angiopoietin-like 2 protein plays a crucial role in inducing sprouting in endothelial cells through autocrine and paracrine mechanisms.It orchestrates angiogenic processes and regulates vascular development.ANGPTL2's versatile impact on endothelial cell behavior positions it as a key modulator in the molecular signals governing angiogenesis.ANGPTL2/Angiopoietin-like 2 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived ANGPTL2/Angiopoietin-like 2 protein, expressed by HEK293 , with N-hFc labeled tag.

ANGPTL2/Angiopoietin-like 2 protein exerts a crucial role in the induction of sprouting in endothelial cells, operating through both autocrine and paracrine mechanisms. The protein's ability to stimulate the outgrowth of new blood vessels reflects its significance in orchestrating angiogenic processes. By promoting sprouting in endothelial cells, ANGPTL2 contributes to the dynamic regulation of vascular development, emphasizing its involvement in fundamental physiological and pathological contexts where angiogenesis plays a pivotal role. The autocrine and paracrine actions of ANGPTL2 underscore its versatile impact on endothelial cell behavior, positioning it as a key modulator in the intricate network of molecular signals governing angiogenesis.

Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse ANGPTL2/Angiopoietin-like 2 at 1 μg/mL (100 μL/well) can bind Recombinant Human ILT-4. The ED50 for this effect is 517.3 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse ANGPTL2/Angiopoietin-like 2 at 1 μg/mL (100 μL/well) can bind Recombinant Human ILT-4.The ED₅₀ for this effect is 517.3ng/mL.

Mouse

HEK293

N-hFc

Q9R045 (D245-H493)

26360  [NCBI]

DQNLKVLPPSLPTMPALTSLPSSTDKPSGPWRDCLQALEDGHSTSSIYLVKPENTNRLMQVWCDQRHDPGGWTVIQRRLDGSVNFFRNWETYKQGFGNIDGEYWLGLENIYWLTNQGNYKLLVTMEDWSGRKVFAEYASFRLEPESEYYKLRLGRYHGNAGDSFTWHNGKQFTTLDRDHDVYTGNCAHYQKGGWWYNACAHSNLNGVWYRGGHYRSRYQDGVYWAEFRGGSYSLKKVVMMIRPNPNTFH

Approximately 58 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.